KEGG   Tupaia chinensis (Chinese tree shrew): 102468263
Entry
102468263         CDS       T02978                                 

Gene name
GNAQ
Definition
(RefSeq) G protein subunit alpha q
  KO
K04634  guanine nucleotide-binding protein G(q) subunit alpha
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04015  Rap1 signaling pathway
tup04020  Calcium signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04062  Chemokine signaling pathway
tup04071  Sphingolipid signaling pathway
tup04261  Adrenergic signaling in cardiomyocytes
tup04270  Vascular smooth muscle contraction
tup04371  Apelin signaling pathway
tup04540  Gap junction
tup04611  Platelet activation
tup04713  Circadian entrainment
tup04720  Long-term potentiation
tup04723  Retrograde endocannabinoid signaling
tup04724  Glutamatergic synapse
tup04725  Cholinergic synapse
tup04726  Serotonergic synapse
tup04728  Dopaminergic synapse
tup04730  Long-term depression
tup04750  Inflammatory mediator regulation of TRP channels
tup04911  Insulin secretion
tup04912  GnRH signaling pathway
tup04915  Estrogen signaling pathway
tup04916  Melanogenesis
tup04918  Thyroid hormone synthesis
tup04921  Oxytocin signaling pathway
tup04922  Glucagon signaling pathway
tup04924  Renin secretion
tup04925  Aldosterone synthesis and secretion
tup04927  Cortisol synthesis and secretion
tup04928  Parathyroid hormone synthesis, secretion and action
tup04929  GnRH secretion
tup04934  Cushing syndrome
tup04935  Growth hormone synthesis, secretion and action
tup04961  Endocrine and other factor-regulated calcium reabsorption
tup04970  Salivary secretion
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup05010  Alzheimer disease
tup05016  Huntington disease
tup05017  Spinocerebellar ataxia
tup05022  Pathways of neurodegeneration - multiple diseases
tup05135  Yersinia infection
tup05142  Chagas disease
tup05143  African trypanosomiasis
tup05146  Amoebiasis
tup05163  Human cytomegalovirus infection
tup05170  Human immunodeficiency virus 1 infection
tup05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102468263 (GNAQ)
   04371 Apelin signaling pathway
    102468263 (GNAQ)
   04020 Calcium signaling pathway
    102468263 (GNAQ)
   04071 Sphingolipid signaling pathway
    102468263 (GNAQ)
   04022 cGMP-PKG signaling pathway
    102468263 (GNAQ)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102468263 (GNAQ)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102468263 (GNAQ)
   04062 Chemokine signaling pathway
    102468263 (GNAQ)
  09152 Endocrine system
   04911 Insulin secretion
    102468263 (GNAQ)
   04922 Glucagon signaling pathway
    102468263 (GNAQ)
   04929 GnRH secretion
    102468263 (GNAQ)
   04912 GnRH signaling pathway
    102468263 (GNAQ)
   04915 Estrogen signaling pathway
    102468263 (GNAQ)
   04921 Oxytocin signaling pathway
    102468263 (GNAQ)
   04935 Growth hormone synthesis, secretion and action
    102468263 (GNAQ)
   04918 Thyroid hormone synthesis
    102468263 (GNAQ)
   04928 Parathyroid hormone synthesis, secretion and action
    102468263 (GNAQ)
   04916 Melanogenesis
    102468263 (GNAQ)
   04924 Renin secretion
    102468263 (GNAQ)
   04925 Aldosterone synthesis and secretion
    102468263 (GNAQ)
   04927 Cortisol synthesis and secretion
    102468263 (GNAQ)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102468263 (GNAQ)
   04270 Vascular smooth muscle contraction
    102468263 (GNAQ)
  09154 Digestive system
   04970 Salivary secretion
    102468263 (GNAQ)
   04971 Gastric acid secretion
    102468263 (GNAQ)
   04972 Pancreatic secretion
    102468263 (GNAQ)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    102468263 (GNAQ)
  09156 Nervous system
   04724 Glutamatergic synapse
    102468263 (GNAQ)
   04725 Cholinergic synapse
    102468263 (GNAQ)
   04728 Dopaminergic synapse
    102468263 (GNAQ)
   04726 Serotonergic synapse
    102468263 (GNAQ)
   04720 Long-term potentiation
    102468263 (GNAQ)
   04730 Long-term depression
    102468263 (GNAQ)
   04723 Retrograde endocannabinoid signaling
    102468263 (GNAQ)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102468263 (GNAQ)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102468263 (GNAQ)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102468263 (GNAQ)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102468263 (GNAQ)
   05016 Huntington disease
    102468263 (GNAQ)
   05017 Spinocerebellar ataxia
    102468263 (GNAQ)
   05022 Pathways of neurodegeneration - multiple diseases
    102468263 (GNAQ)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102468263 (GNAQ)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102468263 (GNAQ)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102468263 (GNAQ)
   05163 Human cytomegalovirus infection
    102468263 (GNAQ)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102468263 (GNAQ)
   05142 Chagas disease
    102468263 (GNAQ)
   05143 African trypanosomiasis
    102468263 (GNAQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tup04147]
    102468263 (GNAQ)
   04031 GTP-binding proteins [BR:tup04031]
    102468263 (GNAQ)
Exosome [BR:tup04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102468263 (GNAQ)
GTP-binding proteins [BR:tup04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    102468263 (GNAQ)
SSDB
Motif
Pfam: G-alpha Arf
Other DBs
NCBI-GeneID: 102468263
NCBI-ProteinID: XP_014442112
LinkDB
Position
Un
AA seq 321 aa
MLSSFQSGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLK
IPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTK
YYLNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIH
CFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDL
LEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIR
FVFAAVKDTILQLNLKEYNLV
NT seq 966 nt   +upstreamnt  +downstreamnt
atgctgagcagcttccaaagtgggacaggcgagagcggcaagagcacgtttatcaagcag
atgaggatcatccacgggtcgggctactctgacgaggacaagaggggcttcaccaagctg
gtgtatcagaacatcttcacggccatgcaagccatgatcagagccatggacacactcaag
atcccgtacaagtacgagcacaataaggctcatgcacagttagttcgagaagtggatgtg
gagaaggtgtctgcttttgagaatccatatgtagatgcaataaagagtttatggaatgat
cctggaatccaggagtgctacgatagacgacgagaatatcagttatccgactctaccaaa
tactatcttaatgacttggaccgcgtagctgaccctgcatacctgcctacgcaacaagat
gtgcttagagttcgagtccccaccacagggatcatcgaatacccctttgacttacaaagt
gtcattttcagaatggtggatgtagggggccaaaggtcagagagaagaaaatggatacac
tgctttgaaaatgtcacctctatcatgtttctagtagcgcttagtgaatatgatcaagtt
cttgtggaatcagacaatgagaatcgaatggaggaaagcaaagcactctttagaacaatt
atcacatatccctggttccagaactcctctgttattctgttcttaaataagaaggatctt
ctagaggagaaaatcatgtattcccatctagttgactacttcccagaatatgatggaccg
cagagagatgcccaggcagctcgagaattcatcctgaagatgttcgtggacctgaaccca
gacagtgacaaaattatctactcccacttcacatgcgccacagacaccgagaatatccgc
tttgtctttgctgccgtcaaggacaccatcctccagttgaatctgaaggagtacaatcta
gtctaa

DBGET integrated database retrieval system