KEGG   Tupaia chinensis (Chinese tree shrew): 102468478
Entry
102468478         CDS       T02978                                 

Gene name
ADCY6
Definition
(RefSeq) adenylate cyclase 6
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00230  Purine metabolism
tup01100  Metabolic pathways
tup01522  Endocrine resistance
tup04015  Rap1 signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04024  cAMP signaling pathway
tup04062  Chemokine signaling pathway
tup04072  Phospholipase D signaling pathway
tup04114  Oocyte meiosis
tup04211  Longevity regulating pathway
tup04213  Longevity regulating pathway - multiple species
tup04261  Adrenergic signaling in cardiomyocytes
tup04270  Vascular smooth muscle contraction
tup04371  Apelin signaling pathway
tup04540  Gap junction
tup04611  Platelet activation
tup04713  Circadian entrainment
tup04714  Thermogenesis
tup04723  Retrograde endocannabinoid signaling
tup04724  Glutamatergic synapse
tup04725  Cholinergic synapse
tup04727  GABAergic synapse
tup04742  Taste transduction
tup04750  Inflammatory mediator regulation of TRP channels
tup04911  Insulin secretion
tup04912  GnRH signaling pathway
tup04913  Ovarian steroidogenesis
tup04914  Progesterone-mediated oocyte maturation
tup04915  Estrogen signaling pathway
tup04916  Melanogenesis
tup04918  Thyroid hormone synthesis
tup04921  Oxytocin signaling pathway
tup04923  Regulation of lipolysis in adipocytes
tup04924  Renin secretion
tup04925  Aldosterone synthesis and secretion
tup04926  Relaxin signaling pathway
tup04927  Cortisol synthesis and secretion
tup04928  Parathyroid hormone synthesis, secretion and action
tup04934  Cushing syndrome
tup04935  Growth hormone synthesis, secretion and action
tup04961  Endocrine and other factor-regulated calcium reabsorption
tup04962  Vasopressin-regulated water reabsorption
tup04970  Salivary secretion
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup04976  Bile secretion
tup05032  Morphine addiction
tup05163  Human cytomegalovirus infection
tup05166  Human T-cell leukemia virus 1 infection
tup05200  Pathways in cancer
tup05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102468478 (ADCY6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102468478 (ADCY6)
   04371 Apelin signaling pathway
    102468478 (ADCY6)
   04072 Phospholipase D signaling pathway
    102468478 (ADCY6)
   04024 cAMP signaling pathway
    102468478 (ADCY6)
   04022 cGMP-PKG signaling pathway
    102468478 (ADCY6)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102468478 (ADCY6)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102468478 (ADCY6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102468478 (ADCY6)
   04062 Chemokine signaling pathway
    102468478 (ADCY6)
  09152 Endocrine system
   04911 Insulin secretion
    102468478 (ADCY6)
   04923 Regulation of lipolysis in adipocytes
    102468478 (ADCY6)
   04912 GnRH signaling pathway
    102468478 (ADCY6)
   04913 Ovarian steroidogenesis
    102468478 (ADCY6)
   04915 Estrogen signaling pathway
    102468478 (ADCY6)
   04914 Progesterone-mediated oocyte maturation
    102468478 (ADCY6)
   04921 Oxytocin signaling pathway
    102468478 (ADCY6)
   04926 Relaxin signaling pathway
    102468478 (ADCY6)
   04935 Growth hormone synthesis, secretion and action
    102468478 (ADCY6)
   04918 Thyroid hormone synthesis
    102468478 (ADCY6)
   04928 Parathyroid hormone synthesis, secretion and action
    102468478 (ADCY6)
   04916 Melanogenesis
    102468478 (ADCY6)
   04924 Renin secretion
    102468478 (ADCY6)
   04925 Aldosterone synthesis and secretion
    102468478 (ADCY6)
   04927 Cortisol synthesis and secretion
    102468478 (ADCY6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102468478 (ADCY6)
   04270 Vascular smooth muscle contraction
    102468478 (ADCY6)
  09154 Digestive system
   04970 Salivary secretion
    102468478 (ADCY6)
   04971 Gastric acid secretion
    102468478 (ADCY6)
   04972 Pancreatic secretion
    102468478 (ADCY6)
   04976 Bile secretion
    102468478 (ADCY6)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102468478 (ADCY6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102468478 (ADCY6)
  09156 Nervous system
   04724 Glutamatergic synapse
    102468478 (ADCY6)
   04727 GABAergic synapse
    102468478 (ADCY6)
   04725 Cholinergic synapse
    102468478 (ADCY6)
   04723 Retrograde endocannabinoid signaling
    102468478 (ADCY6)
  09157 Sensory system
   04742 Taste transduction
    102468478 (ADCY6)
   04750 Inflammatory mediator regulation of TRP channels
    102468478 (ADCY6)
  09149 Aging
   04211 Longevity regulating pathway
    102468478 (ADCY6)
   04213 Longevity regulating pathway - multiple species
    102468478 (ADCY6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102468478 (ADCY6)
   04714 Thermogenesis
    102468478 (ADCY6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102468478 (ADCY6)
  09165 Substance dependence
   05032 Morphine addiction
    102468478 (ADCY6)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102468478 (ADCY6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102468478 (ADCY6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102468478 (ADCY6)
   05163 Human cytomegalovirus infection
    102468478 (ADCY6)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102468478 (ADCY6)
Enzymes [BR:tup01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102468478 (ADCY6)
SSDB
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD Shisa
Other DBs
NCBI-GeneID: 102468478
NCBI-ProteinID: XP_006168285
UniProt: L8Y3N4
LinkDB
Position
Un
AA seq 1166 aa
MSWFSGLLVPKVDERKTAWGERNGQKRSRRGTRASGFCTPRYMSCLQDTEPPSPTPAAPS
RCPWQDEAFIRKGGLGKGMELGRRAVALGFEDTEVTAAIGTAEVAPDISPRIGRSCWRRL
AQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLTVVLLAFHAAPSRPQPAYVA
LLSCAATLFVALMVVCNRHSFRQDSMWVVSYVVLGILAAVQIGGTLAAQPHSPSAGLWCP
VFFVYITYTLLPIRMRAAVLSGLGLSTLHLILAWQLNRSDAFLWKQLGANVLLFLCTNVI
GICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKK
EDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLR
IKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHC
GVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNAYL
KEQHIETFLILGASQKRKEEKAMLAKLQRTRANSMEGLVPRWVPDRAFSRTKDSKAFRQM
GIDDSSKDNRGAQDALNPEDEVDEFLGRAIDARSIDQLRKDHVRRFLLTFQRDDLEKKYS
RKVDPRFGAYVACALLVFCFICFIQLLVFPHSTLMLGIYASIFLLLLVTVLICAVYSCGS
LFPKALQRLSRSIVRSRAHSTAVGIFSVLLVFTSAIANMFTCNHTPIRTCAARMLNLTPA
DITACHLQQLNYSLGLDAPLCEGTAPTCSFPEYFVGNMLLSLLASSVFLHISSIGKLAMI
FVLGLIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKYMTPVIL
LVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLA
RERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEE
RFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQMKHINEHSFNNFQ
MKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTADLYQVLAAKGYQ
LECRGVVKVKGKGEMTTYFLNGGPSS
NT seq 3501 nt   +upstreamnt  +downstreamnt
atgtcgtggtttagcggcctcctggtccccaaagtggatgaacggaagacagcctggggt
gaacgcaatgggcagaagcggtcgcgccgtgggactcgggccagtggcttctgcacaccc
cgctacatgagctgcctccaggacacggagccgcccagccccacccctgcggctccctct
cggtgcccctggcaggatgaggcctttatccggaagggtggcctaggcaagggtatggag
ctgggtcggcgggcagtagccctgggcttcgaggacactgaggtgacagcagctatcggg
acagctgaggtggcacctgatatatcacccaggattgggcgatcctgctggcgtcgtctg
gcacaggtgttccagtcgaagcagttccgctcggccaagctggagcgcctgtaccagcgg
tacttctttcagatgaaccagagcagcctgacgctgctgatggcggtgctggttctgctc
acggtggtgctgctggccttccatgctgcgccctcccgccctcagcctgcctatgtggcc
ctgctgtcctgcgctgccaccctctttgtggcactcatggtggtgtgcaaccgacatagc
tttcgccaggactccatgtgggtggtgagctacgtggtgctggggatcctcgcggctgtg
cagattgggggcactctggcagcccaaccacacagcccctctgccggcctctggtgccct
gtgttctttgtctacatcacctacacgctcctaccaatccgtatgcgagctgccgtcctc
agcggcctgggcctctccaccctacatctcatcttggcctggcagctcaaccgtagtgat
gccttcctctggaagcagcttggtgccaatgtgctgctgttcctctgtaccaatgtcatt
ggcatctgcacacactacccagccgaggtgtctcagcgccaggcctttcaggagactcgc
ggttacatccaggcacggctgcatctgcagcatgagaatcggcagcaggagcggctgctg
ctgtcggtgttgccccagcacgttgccatggagatgaaagaagacatcaacacaaaaaaa
gaagacatgatgttccacaagatctatatccagaaacacgacaacgtcagcatcctgttt
gcagacattgaaggcttcaccagcctggcatcccagtgcactgcacaggagctggtcatg
accctgaacgaactctttgcccggtttgacaagttggcagcggaaaatcactgcctgagg
atcaagatcttaggggactgttactactgtgtgtcaggcctgccggaggcccgggcagac
cacgcccactgctgcgtggagatgggggtggacatgatcgaggccatttcgctggtgcgt
gaggtgacaggtgtgaacgtgaacatgcgtgtaggcatccacagcgggcgtgtgcactgc
ggcgtccttggcctgaggaaatggcagttcgacgtgtggtccaacgacgtgaccctggcc
aaccatatggaggcagggggccgggctggtcgtatccacatcactcgggccacactgcag
tacctgaatggggactacgaggtggagccaggccggggcggcgagcgcaatgcgtacctg
aaggagcagcacattgagaccttcctcatcctgggcgccagccagaaacggaaagaggag
aaggccatgctggccaagctgcagcggacgcgggccaactccatggaagggctggtgccg
cgctgggtgccagatcgtgccttctcccggaccaaggactccaaggccttccgccagatg
ggcattgatgactccagcaaagacaaccggggcgcccaagatgccctgaaccctgaggac
gaggtagatgagttcctgggccgggccatcgatgcccgcagcatcgatcagctgcgcaag
gaccacgtgcgccggttcctgctcaccttccagagagacgatcttgagaagaagtactca
cggaaggtggatccccgcttcggagcctacgttgcctgtgccttgttggtcttctgtttc
atctgcttcatccagctcctcgtcttcccgcactcaaccctgatgcttggtatctacgcc
agtatcttcctgctgttgctggtcactgtgctgatctgcgcggtgtactcctgtggttct
ctgtttcctaaggccctgcaacgactgtcccgcagcattgtccgctcacgggcacacagc
actgcagtcggcatcttttcagtcctgcttgtattcacttctgccattgccaacatgttc
acctgtaaccacacccccatacggacctgtgctgcccggatgctgaatttaacacctgct
gacatcactgcctgccacctgcagcagctcaattactccctgggcttggatgctcccctg
tgtgagggcaccgcacccacctgcagcttccctgagtacttcgtcgggaacatgctgctg
agtctcttggccagctctgtcttcctacacatcagcagtattgggaagttggccatgatc
tttgtcttggggctcatctatttggtgctgcttctgctgggtcccccagccaccatcttt
gacaactatgacctgctgcttggcgtccatggcttggcttcttccaatgagacctttgat
gggctggactgcccagctgcagggagggtggcactcaaatatatgacccccgtgattctg
ctggtatttgcgctggcactgtatctgcatgcccagcaggtggagtcaactgcccgcctg
gacttcctctggaaactccaggcaacaggggagaaggaggagatggaggagctccaggcg
tacaaccggcggctgctacacaacattctgcccaaggacgtggccgcccacttcttggcc
cgggagcgccggaatgatgagctctactatcagtcgtgtgagtgtgtggctgttatgttt
gcctccattgccaacttctcagagttctatgtggagctggaggcaaacaatgagggcgtc
gagtgcctgcgactgctcaatgagatcatcgctgactttgatgagatcatcagcgaggag
cggttccgacagctggagaagatcaagacgattggcagcacctacatggctgcctccggg
ctgaacgccagcacctacgatcaggtgggccgctcccacatcacggccctggccgactac
gccatgcggctcatggagcaaatgaagcacatcaatgagcactccttcaataatttccag
atgaagatcgggctgaacatgggcccagtcgtggcaggcgtcattggagctcggaagcca
cagtatgacatctgggggaacacagtgaatgtttctagccggatggacagcacaggggtc
cctgaccgaatccaggtgaccgcggacctgtaccaggttctagctgccaagggctaccag
ctggagtgtcgaggggtggtcaaggtgaagggcaagggagagatgaccacctacttcctc
aatgggggccccagcagttag

KEGG   Tupaia chinensis (Chinese tree shrew): 102468873
Entry
102468873         CDS       T02978                                 

Gene name
ADCY1
Definition
(RefSeq) adenylate cyclase 1
  KO
K08041  adenylate cyclase 1 [EC:4.6.1.1]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00230  Purine metabolism
tup01100  Metabolic pathways
tup01522  Endocrine resistance
tup04015  Rap1 signaling pathway
tup04020  Calcium signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04024  cAMP signaling pathway
tup04062  Chemokine signaling pathway
tup04072  Phospholipase D signaling pathway
tup04114  Oocyte meiosis
tup04211  Longevity regulating pathway
tup04213  Longevity regulating pathway - multiple species
tup04261  Adrenergic signaling in cardiomyocytes
tup04270  Vascular smooth muscle contraction
tup04371  Apelin signaling pathway
tup04540  Gap junction
tup04611  Platelet activation
tup04713  Circadian entrainment
tup04714  Thermogenesis
tup04720  Long-term potentiation
tup04723  Retrograde endocannabinoid signaling
tup04724  Glutamatergic synapse
tup04725  Cholinergic synapse
tup04727  GABAergic synapse
tup04750  Inflammatory mediator regulation of TRP channels
tup04911  Insulin secretion
tup04912  GnRH signaling pathway
tup04913  Ovarian steroidogenesis
tup04914  Progesterone-mediated oocyte maturation
tup04915  Estrogen signaling pathway
tup04916  Melanogenesis
tup04918  Thyroid hormone synthesis
tup04921  Oxytocin signaling pathway
tup04923  Regulation of lipolysis in adipocytes
tup04925  Aldosterone synthesis and secretion
tup04926  Relaxin signaling pathway
tup04927  Cortisol synthesis and secretion
tup04928  Parathyroid hormone synthesis, secretion and action
tup04934  Cushing syndrome
tup04935  Growth hormone synthesis, secretion and action
tup04970  Salivary secretion
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup04976  Bile secretion
tup05032  Morphine addiction
tup05142  Chagas disease
tup05146  Amoebiasis
tup05163  Human cytomegalovirus infection
tup05166  Human T-cell leukemia virus 1 infection
tup05200  Pathways in cancer
tup05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102468873 (ADCY1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102468873 (ADCY1)
   04371 Apelin signaling pathway
    102468873 (ADCY1)
   04020 Calcium signaling pathway
    102468873 (ADCY1)
   04072 Phospholipase D signaling pathway
    102468873 (ADCY1)
   04024 cAMP signaling pathway
    102468873 (ADCY1)
   04022 cGMP-PKG signaling pathway
    102468873 (ADCY1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102468873 (ADCY1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102468873 (ADCY1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102468873 (ADCY1)
   04062 Chemokine signaling pathway
    102468873 (ADCY1)
  09152 Endocrine system
   04911 Insulin secretion
    102468873 (ADCY1)
   04923 Regulation of lipolysis in adipocytes
    102468873 (ADCY1)
   04912 GnRH signaling pathway
    102468873 (ADCY1)
   04913 Ovarian steroidogenesis
    102468873 (ADCY1)
   04915 Estrogen signaling pathway
    102468873 (ADCY1)
   04914 Progesterone-mediated oocyte maturation
    102468873 (ADCY1)
   04921 Oxytocin signaling pathway
    102468873 (ADCY1)
   04926 Relaxin signaling pathway
    102468873 (ADCY1)
   04935 Growth hormone synthesis, secretion and action
    102468873 (ADCY1)
   04918 Thyroid hormone synthesis
    102468873 (ADCY1)
   04928 Parathyroid hormone synthesis, secretion and action
    102468873 (ADCY1)
   04916 Melanogenesis
    102468873 (ADCY1)
   04925 Aldosterone synthesis and secretion
    102468873 (ADCY1)
   04927 Cortisol synthesis and secretion
    102468873 (ADCY1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102468873 (ADCY1)
   04270 Vascular smooth muscle contraction
    102468873 (ADCY1)
  09154 Digestive system
   04970 Salivary secretion
    102468873 (ADCY1)
   04971 Gastric acid secretion
    102468873 (ADCY1)
   04972 Pancreatic secretion
    102468873 (ADCY1)
   04976 Bile secretion
    102468873 (ADCY1)
  09156 Nervous system
   04724 Glutamatergic synapse
    102468873 (ADCY1)
   04727 GABAergic synapse
    102468873 (ADCY1)
   04725 Cholinergic synapse
    102468873 (ADCY1)
   04720 Long-term potentiation
    102468873 (ADCY1)
   04723 Retrograde endocannabinoid signaling
    102468873 (ADCY1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102468873 (ADCY1)
  09149 Aging
   04211 Longevity regulating pathway
    102468873 (ADCY1)
   04213 Longevity regulating pathway - multiple species
    102468873 (ADCY1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102468873 (ADCY1)
   04714 Thermogenesis
    102468873 (ADCY1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102468873 (ADCY1)
  09165 Substance dependence
   05032 Morphine addiction
    102468873 (ADCY1)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102468873 (ADCY1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102468873 (ADCY1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102468873 (ADCY1)
   05163 Human cytomegalovirus infection
    102468873 (ADCY1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102468873 (ADCY1)
   05142 Chagas disease
    102468873 (ADCY1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102468873 (ADCY1)
Enzymes [BR:tup01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102468873 (ADCY1)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 HNOBA
Other DBs
NCBI-GeneID: 102468873
NCBI-ProteinID: XP_006166099
LinkDB
Position
Un
AA seq 842 aa
MYGVFVRILTERSQRKAFLQARSCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLK
PPERIFHKIYIQRHDNVSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCR
RIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVL
CGVLGLRKWQYDVWSNDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPGYGHERNSF
LKTHNIETFFIVPSHRRKIFPGLILSDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFS
NVMTCEDDDKRRALRTASEKLRNRSSFSANVVQTTPGTRVNRYLSRLLEARQPELELADL
NFFTLKYKHAEREQKYHQLQDEYFTSAVVLALILAALFGLVYLLVIPQSLAVLLLLVFCI
CFLVACVLYLHITRVQCFPGCLTIQIRTVLCIFIVVLIYSVAQGCVVGCLPWGWSPKSNI
SLAVISSGSRHPVLPALPCESTHHALLCCLVGTLPLAIFLRVSSVPKMILLSGLTTSYIL
VLELSGYTKAGGGASSGRSYEPILAILLFSCALALHARQVDVRLRLDYLWAAQAEEERDD
MERVKLDNKRILFNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELD
GNNMGVECLRLLNEIIADFDELMEKDFYKDLEKIKTIGSTYMAAVGLAPTVGTKAKKSIS
SHLSTLADFAIEMFDVLDEINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNV
ASRMDSTGVQGRIQLYSKDGALALVFKQQPARLPRSAGKVLGWSRMGTALIQSLWPMFHD
RQ
NT seq 2529 nt   +upstreamnt  +downstreamnt
atgtacggcgtcttcgtgcggatccttaccgagcgctcgcagaggaaggcattcctacag
gcccggagctgcattgaggaccggctgcgactggaggatgagaacgagaagcaggagcgg
ctcctcatgagcctcctgccccggaacgttgccatggagatgaaggaggacttcctcaag
cccccggagaggattttccacaagatttacatccagaggcacgacaatgtgagcatcctg
tttgcagacatcgttggcttcacaggcttggcatcccagtgcacagcccaggagctggtg
aaactcctcaatgagctctttggaaagttcgacgagttagccacggagaaccactgtcgt
cgcatcaagatcctgggggattgttactactgcgtgtcaggtctcacccagcccaagact
gaccacgcccactgctgcgtggagatggggcttgacatgatcgacaccatcacgtctgtg
gccgaggccactgaggtggacctgaacatgcgcgtggggctgcacaccggtcgggtcctc
tgtggtgtcctgggcctgcgcaagtggcaatacgatgtgtggtccaacgacgtgacccta
gccaatgtcatggaagccgctggcctgccagggaaggttcacatcacaaagacaacctta
gcgtgcctgaatggagactatgaggtggagccgggttatggacatgagaggaacagtttc
ttgaaaactcacaacattgagacctttttcattgtgccatcccatcggcggaagatattt
ccaggcctgattctgtcggatatcaagcctgccaagaggatgaagttcaagactgtgtgc
tacctgctggtgcagctcatgcactgccggaagatgttcaaggctgagatccccttctcc
aatgtcatgacctgtgaggatgatgacaagcggagggcactgagaactgcctcggagaaa
ctcagaaaccgctcatccttctctgcgaatgtggtccaaaccacgcccggcacgcgtgtc
aacaggtacctcagccgcctcttggaagcccgccagccggagctggagcttgctgatctg
aacttcttcaccctgaagtacaaacatgccgagcgggagcaaaagtaccaccagcttcag
gacgagtatttcaccagcgccgtcgtcctcgccctcatcctggctgccttattcggcctt
gtctaccttctggtaatcccacagagcctggccgtcctgctcctgctagtgttctgcatc
tgcttcctggtggcgtgtgtcctgtacctgcacatcactcgggtccagtgttttccaggg
tgcctgacgattcagattcgcaccgtgctgtgtattttcatcgtggtcttaatctactca
gtagcccaaggttgtgtggtgggctgcctcccctggggttggagccccaagtccaacatt
tccctggcggtcatctcgtctgggagccgacaccctgtgctgcctgctctgccctgtgag
tccacgcaccatgccctgctctgctgcctggtgggcaccctcccgctcgccatcttcctg
cgggtgtcctctgtgccaaaaatgatcctgctgtctgggctcaccacgtcttacatcctg
gtcctggagctcagcgggtacaccaaggctgggggcggcgccagctcgggacgcagctat
gagcccatcctggccattctgctgttctcgtgtgcactggccctgcacgcacggcaggtg
gacgtcaggctgcggttggactacctctgggccgcgcaggcagaagaggagcgagatgac
atggagagagtgaagctggacaacaagcggatcctcttcaacctcctgccagcccacgtg
gcccagcacttcctcatgtccaatccccggaacatggacctttactaccagtcctactcc
caggtgggtgtcatgttcgcctccatcccgaacttcaatgacttctacattgagctggat
ggcaacaacatgggtgtggagtgtctgcggcttcttaatgagatcatcgctgacttcgat
gagctcatggagaaagacttttacaaggacctagagaagatcaagaccattgggagcacc
tacatggctgcagtgggactggcgcccacagtggggaccaaggctaagaagtctatctcc
tcccacctgagcacgctggccgactttgccattgagatgtttgacgtcctggatgagatc
aactaccagtcttataacgacttcgtcctccgtgttggcatcaacgtcggccccgtggtg
gctggggtgattggcgcgcgcaggccgcagtacgacatctgggggaacacggtcaatgtg
gctagtcgaatggacagcaccggcgtccagggcagaatccagctttactctaaagatgga
gcattggccctagtgttcaagcagcaacctgcaaggctgcctcgttcggctggaaaggtc
ttaggctggtcgcgcatggggacagcactgattcagtctctgtggccaatgtttcatgat
cggcagtga

KEGG   Tupaia chinensis (Chinese tree shrew): 102472317
Entry
102472317         CDS       T02978                                 

Gene name
ADCY8
Definition
(RefSeq) adenylate cyclase 8
  KO
K08048  adenylate cyclase 8 [EC:4.6.1.1]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00230  Purine metabolism
tup01100  Metabolic pathways
tup01522  Endocrine resistance
tup04015  Rap1 signaling pathway
tup04020  Calcium signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04024  cAMP signaling pathway
tup04062  Chemokine signaling pathway
tup04072  Phospholipase D signaling pathway
tup04114  Oocyte meiosis
tup04211  Longevity regulating pathway
tup04213  Longevity regulating pathway - multiple species
tup04261  Adrenergic signaling in cardiomyocytes
tup04270  Vascular smooth muscle contraction
tup04371  Apelin signaling pathway
tup04540  Gap junction
tup04611  Platelet activation
tup04713  Circadian entrainment
tup04714  Thermogenesis
tup04720  Long-term potentiation
tup04723  Retrograde endocannabinoid signaling
tup04724  Glutamatergic synapse
tup04725  Cholinergic synapse
tup04727  GABAergic synapse
tup04742  Taste transduction
tup04750  Inflammatory mediator regulation of TRP channels
tup04911  Insulin secretion
tup04912  GnRH signaling pathway
tup04913  Ovarian steroidogenesis
tup04914  Progesterone-mediated oocyte maturation
tup04915  Estrogen signaling pathway
tup04916  Melanogenesis
tup04918  Thyroid hormone synthesis
tup04921  Oxytocin signaling pathway
tup04923  Regulation of lipolysis in adipocytes
tup04925  Aldosterone synthesis and secretion
tup04926  Relaxin signaling pathway
tup04927  Cortisol synthesis and secretion
tup04928  Parathyroid hormone synthesis, secretion and action
tup04934  Cushing syndrome
tup04935  Growth hormone synthesis, secretion and action
tup04970  Salivary secretion
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup04976  Bile secretion
tup05032  Morphine addiction
tup05163  Human cytomegalovirus infection
tup05166  Human T-cell leukemia virus 1 infection
tup05200  Pathways in cancer
tup05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102472317 (ADCY8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102472317 (ADCY8)
   04371 Apelin signaling pathway
    102472317 (ADCY8)
   04020 Calcium signaling pathway
    102472317 (ADCY8)
   04072 Phospholipase D signaling pathway
    102472317 (ADCY8)
   04024 cAMP signaling pathway
    102472317 (ADCY8)
   04022 cGMP-PKG signaling pathway
    102472317 (ADCY8)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102472317 (ADCY8)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102472317 (ADCY8)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102472317 (ADCY8)
   04062 Chemokine signaling pathway
    102472317 (ADCY8)
  09152 Endocrine system
   04911 Insulin secretion
    102472317 (ADCY8)
   04923 Regulation of lipolysis in adipocytes
    102472317 (ADCY8)
   04912 GnRH signaling pathway
    102472317 (ADCY8)
   04913 Ovarian steroidogenesis
    102472317 (ADCY8)
   04915 Estrogen signaling pathway
    102472317 (ADCY8)
   04914 Progesterone-mediated oocyte maturation
    102472317 (ADCY8)
   04921 Oxytocin signaling pathway
    102472317 (ADCY8)
   04926 Relaxin signaling pathway
    102472317 (ADCY8)
   04935 Growth hormone synthesis, secretion and action
    102472317 (ADCY8)
   04918 Thyroid hormone synthesis
    102472317 (ADCY8)
   04928 Parathyroid hormone synthesis, secretion and action
    102472317 (ADCY8)
   04916 Melanogenesis
    102472317 (ADCY8)
   04925 Aldosterone synthesis and secretion
    102472317 (ADCY8)
   04927 Cortisol synthesis and secretion
    102472317 (ADCY8)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102472317 (ADCY8)
   04270 Vascular smooth muscle contraction
    102472317 (ADCY8)
  09154 Digestive system
   04970 Salivary secretion
    102472317 (ADCY8)
   04971 Gastric acid secretion
    102472317 (ADCY8)
   04972 Pancreatic secretion
    102472317 (ADCY8)
   04976 Bile secretion
    102472317 (ADCY8)
  09156 Nervous system
   04724 Glutamatergic synapse
    102472317 (ADCY8)
   04727 GABAergic synapse
    102472317 (ADCY8)
   04725 Cholinergic synapse
    102472317 (ADCY8)
   04720 Long-term potentiation
    102472317 (ADCY8)
   04723 Retrograde endocannabinoid signaling
    102472317 (ADCY8)
  09157 Sensory system
   04742 Taste transduction
    102472317 (ADCY8)
   04750 Inflammatory mediator regulation of TRP channels
    102472317 (ADCY8)
  09149 Aging
   04211 Longevity regulating pathway
    102472317 (ADCY8)
   04213 Longevity regulating pathway - multiple species
    102472317 (ADCY8)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102472317 (ADCY8)
   04714 Thermogenesis
    102472317 (ADCY8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102472317 (ADCY8)
  09165 Substance dependence
   05032 Morphine addiction
    102472317 (ADCY8)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102472317 (ADCY8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102472317 (ADCY8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102472317 (ADCY8)
   05163 Human cytomegalovirus infection
    102472317 (ADCY8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102472317 (ADCY8)
Enzymes [BR:tup01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102472317 (ADCY8)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 TBK1_ULD
Other DBs
NCBI-GeneID: 102472317
NCBI-ProteinID: XP_006156759
LinkDB
Position
Un
AA seq 1256 aa
MELSDVRCLSGSEELYTIHPTPPAGDSGGGPPPGGGGPQRLLWQTAVRHITEQRFIHGHR
GAGGGGSGGSGKASNLAGGGLNHHAPQLASDSALPLYSLGPGERAHSTGSTKVFPERSGS
GSASGSGGGGDLGFLHLDCAPSNSDFFLNGGYSYRGVIFPTLRNSFKSRDLERLYQRYFL
GQRRKSEVVMNVLDVLTKLTLLVLHLSLASAPMDPLKGILLGFFTGIEVVICALVVVRKD
TTSHTYLQYSAVVTWVAMTTQILAAGLGYGLLGDGIGYVLFTLFATYSMLPLPLTWAILA
GLGTSLLQLILQVVIPRLVVISINQVVAQAVLFMCMNTAGIFISYLSDRAQRQAFLETRR
CVEARLRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSI
LFADVKGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPR
QDHAHCCVEMGLSMIKTIRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVD
IANKLESGGIPGRIHISKATLDCLNGDYNVEEGHGKERNEFLRKHNIETYLIKQPEESLL
SLPEDIVKESVSASDRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLA
QALHVQSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSN
LVCAFIVLLFITAIQSLLPSSRVMPMTIQFSILIMLHSALVLITTAEDYKCLPLVLRKTC
CWINETYLARNVIIFASILINFLGAILNILWCDFDKSIPLKNLTFNSSAVFTDICSYPEY
FVFTGVLAMVTCAVFLRLNSVLKLAVLLIMIAIYALLTETLYAGLFLRYDNLNHSGEDFL
GTKEASLLLMAMFLLAVFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNIL
PSHVARHFLEKDRDNEELYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEII
ADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQ
EINKHSFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGLSGRIQVPEE
TYLILKDQGFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAV
VLGLVQSLNRQRQKQLLNENNNTGIIKGHYNRRTLLTPSGPEPGVQAEGTDKSDLP
NT seq 3771 nt   +upstreamnt  +downstreamnt
atggagctctcggatgtgcgctgccttagcggcagcgaggaactctacaccatccacccg
acgcccccggccggcgacagcgggggggggcccccccccgggggtggcgggccgcagcgg
ctgctgtggcagacggcggtgcggcacatcacggagcagcgcttcattcatgggcaccgg
ggcgccggaggtggtgggagcggaggttcaggcaaagcctccaacctggccggaggcggt
ctcaaccatcacgcaccgcagctggccagtgactccgcactgccgctctactcgctgggc
cctggggagcgagcgcacagcaccggcagcaccaaagtcttcccggaacgcagcgggagc
ggcagtgccagcggcagcggaggcggaggcgacctgggcttcttgcaccttgactgtgcc
ccaagcaactcggatttcttcctcaatgggggctatagctaccgaggggtcattttcccc
accctgcgcaactccttcaagtctcgggatctggaacgcctctaccagcgctatttcctg
ggccaaaggcgcaaatccgaagtggtgatgaatgtactggacgtgctgaccaaactcacc
ctcttggtcctccacttgagcctggcctctgctcccatggacccgctcaagggcatcctg
ttgggcttcttcaccggcatcgaagtggtgatctgtgccctcgtggtggtcaggaaggac
accacctcgcacacatacctgcagtacagtgccgtggtcacctgggtggccatgaccacc
cagatcctggcagcaggccttggttacgggcttctgggagacggcataggctacgtgctc
ttcacactcttcgccacctacagcatgctgccgctgccactcacgtgggccatcctagcc
ggcctgggcacctcgctgctgcagctgatccttcaggtggtcatcccgcgactggtggtc
atttccatcaaccaggtggtggcccaggctgtgttgttcatgtgtatgaacacagctgga
atcttcatcagctacctgtcagaccgggctcagcgacaagccttcctggagacacggaga
tgtgtggaggccaggttgcgcctggagacagagaaccaaagacaggagcggcttgtgctg
tctgtgcttccccggtttgtcgtcctggaaatgatcaatgacatgaccaatgtggaagat
gagcacctgcaacaccaattccatcggatctacatccatcgctatgagaacgtcagtatt
ctttttgcagatgttaaaggatttaccaacctctctacgaccttgtctgctcaggagctg
gtcaggatgctcaacgagctctttgccagatttgatcgactggcccatgagcatcactgc
ctccgcattaaaatcctgggagactgctactactgtgtctctgggcttcctgagccccgc
caggaccatgcccactgctgtgtggaaatgggcctcagcatgatcaaaaccatcagatat
gtgcggtcaaggacaaagcatgacgttgacatgcggattgggatccactcaggctcagtg
ctgtgtggagtgctgggccttaggaagtggcagtttgatgtctggtcttgggatgtggac
atcgcaaacaaactggaatctggaggaatccctgggaggatccacatttccaaagccaca
ctggattgcctcaacggtgactataatgtggaagagggtcatggtaaagagaggaatgag
ttcttgaggaaacataatatagagacctatttgattaagcagcctgaggaaagtctgcta
tccttgcccgaagacattgtcaaggagtcggtgagcgcttcagacaggagaaatagtggg
gctacattcacagaaggatcctggagtcctgaactgccctttgataacattgtggggaaa
caaaacactctggctgccctaacaagaaattcaataaatctgcttccaaaccatcttgca
caagctttgcatgtccagtctgggcctgaggaaattaacaagagaatagaacataccatc
gacttgcggagtggcgataaattgagaagagagcatatcaagccattctcactgatgttt
aaagactccagcctggagcacaagtattctcaaatgagggatgaagtgttcaagtcaaac
ttggtctgcgcatttatcgttctcctatttatcacagcaatacaaagtttgcttccttct
tcaagagtgatgccaatgaccatccagttctccatcctgataatgctgcactcagctctg
gtcctcatcaccacggcagaggattataagtgtttgcccctcgtcctccggaaaacttgc
tgttggattaatgagacctatttggcccggaacgtcatcatctttgcatccatattgatt
aattttctgggtgccatcctaaatattctgtggtgtgattttgacaagtcgatacccttg
aagaacctgactttcaattcctcagctgtgtttacagatatctgctcctacccagagtac
ttcgtcttcacgggggtgttggccatggtgacctgtgctgttttcctccgacttaactcc
gtcctgaagctggcagtgctgttgattatgattgccatctatgccctgttgaccgagacc
ctctatgcaggtctctttctgcgttatgacaacctgaaccacagtggagaagatttcctg
ggaaccaaggaagcatccctgctgctgatggccatgtttctcctcgctgtattctaccat
ggacagcagctggagtacacagcccgactggacttcctttggcgagtacaggccaaagag
gagatcaatgagatgaaggaactgagggaacacaacgagaacatgctccggaatatctta
cccagtcatgtggcccgccattttctggagaaagaccgggacaatgaggagctgtattct
caatcctatgatgctgttggggtgatgtttgcctccatcccagggtttgcagacttttac
tctcagactgaaatgaataaccagggagtggaatgcctacgcttgctgaatgagatcatt
gctgactttgatgagcttcttggtgaagaccggtttcaagatatagaaaagattaagacg
attggcagcacctacatggctgtttcaggcctgtcccctgaaaaacagcaatgtgaggac
aagtggggacacttgtgtgctctggctgatttctctcttgccctgaccgaaagcatccag
gagatcaataagcattcgttcaacaactttgaactccggattggcatcagccatggctca
gtggtagctggagttattggcgcaaagaaaccacagtatgacatttggggcaaaaccgtg
aacctggcaagccgaatggacagtactgggcttagtggccggatccaagtcccagaggag
acctatctcatcctgaaggaccagggctttgcttttgactaccgaggggagatctacgta
aaaggcatcagtgaacaggaaggaaaaattaaaacgtactttctcctgggaagagttcaa
cccaacccattcatcttgcccccaagaagactgcctgggcaatactctttggctgctgtc
gtcctgggccttgtccagtccctcaacaggcaaaggcagaagcagctactgaatgagaac
aacaacacgggcatcatcaagggtcattataaccggcggactttgttgacacccagtggg
ccagagcctggagtccaagctgaaggcaccgacaaatctgatttgccataa

KEGG   Tupaia chinensis (Chinese tree shrew): 102477344
Entry
102477344         CDS       T02978                                 

Gene name
ADCY9
Definition
(RefSeq) adenylate cyclase 9
  KO
K08049  adenylate cyclase 9 [EC:4.6.1.1]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00230  Purine metabolism
tup01100  Metabolic pathways
tup01522  Endocrine resistance
tup04015  Rap1 signaling pathway
tup04020  Calcium signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04024  cAMP signaling pathway
tup04062  Chemokine signaling pathway
tup04072  Phospholipase D signaling pathway
tup04114  Oocyte meiosis
tup04211  Longevity regulating pathway
tup04213  Longevity regulating pathway - multiple species
tup04261  Adrenergic signaling in cardiomyocytes
tup04270  Vascular smooth muscle contraction
tup04371  Apelin signaling pathway
tup04540  Gap junction
tup04611  Platelet activation
tup04713  Circadian entrainment
tup04714  Thermogenesis
tup04723  Retrograde endocannabinoid signaling
tup04724  Glutamatergic synapse
tup04725  Cholinergic synapse
tup04727  GABAergic synapse
tup04750  Inflammatory mediator regulation of TRP channels
tup04911  Insulin secretion
tup04912  GnRH signaling pathway
tup04913  Ovarian steroidogenesis
tup04914  Progesterone-mediated oocyte maturation
tup04915  Estrogen signaling pathway
tup04916  Melanogenesis
tup04918  Thyroid hormone synthesis
tup04921  Oxytocin signaling pathway
tup04923  Regulation of lipolysis in adipocytes
tup04925  Aldosterone synthesis and secretion
tup04926  Relaxin signaling pathway
tup04927  Cortisol synthesis and secretion
tup04928  Parathyroid hormone synthesis, secretion and action
tup04934  Cushing syndrome
tup04935  Growth hormone synthesis, secretion and action
tup04961  Endocrine and other factor-regulated calcium reabsorption
tup04962  Vasopressin-regulated water reabsorption
tup04970  Salivary secretion
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup04976  Bile secretion
tup05032  Morphine addiction
tup05163  Human cytomegalovirus infection
tup05166  Human T-cell leukemia virus 1 infection
tup05200  Pathways in cancer
tup05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102477344 (ADCY9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102477344 (ADCY9)
   04371 Apelin signaling pathway
    102477344 (ADCY9)
   04020 Calcium signaling pathway
    102477344 (ADCY9)
   04072 Phospholipase D signaling pathway
    102477344 (ADCY9)
   04024 cAMP signaling pathway
    102477344 (ADCY9)
   04022 cGMP-PKG signaling pathway
    102477344 (ADCY9)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102477344 (ADCY9)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102477344 (ADCY9)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102477344 (ADCY9)
   04062 Chemokine signaling pathway
    102477344 (ADCY9)
  09152 Endocrine system
   04911 Insulin secretion
    102477344 (ADCY9)
   04923 Regulation of lipolysis in adipocytes
    102477344 (ADCY9)
   04912 GnRH signaling pathway
    102477344 (ADCY9)
   04913 Ovarian steroidogenesis
    102477344 (ADCY9)
   04915 Estrogen signaling pathway
    102477344 (ADCY9)
   04914 Progesterone-mediated oocyte maturation
    102477344 (ADCY9)
   04921 Oxytocin signaling pathway
    102477344 (ADCY9)
   04926 Relaxin signaling pathway
    102477344 (ADCY9)
   04935 Growth hormone synthesis, secretion and action
    102477344 (ADCY9)
   04918 Thyroid hormone synthesis
    102477344 (ADCY9)
   04928 Parathyroid hormone synthesis, secretion and action
    102477344 (ADCY9)
   04916 Melanogenesis
    102477344 (ADCY9)
   04925 Aldosterone synthesis and secretion
    102477344 (ADCY9)
   04927 Cortisol synthesis and secretion
    102477344 (ADCY9)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102477344 (ADCY9)
   04270 Vascular smooth muscle contraction
    102477344 (ADCY9)
  09154 Digestive system
   04970 Salivary secretion
    102477344 (ADCY9)
   04971 Gastric acid secretion
    102477344 (ADCY9)
   04972 Pancreatic secretion
    102477344 (ADCY9)
   04976 Bile secretion
    102477344 (ADCY9)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102477344 (ADCY9)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102477344 (ADCY9)
  09156 Nervous system
   04724 Glutamatergic synapse
    102477344 (ADCY9)
   04727 GABAergic synapse
    102477344 (ADCY9)
   04725 Cholinergic synapse
    102477344 (ADCY9)
   04723 Retrograde endocannabinoid signaling
    102477344 (ADCY9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102477344 (ADCY9)
  09149 Aging
   04211 Longevity regulating pathway
    102477344 (ADCY9)
   04213 Longevity regulating pathway - multiple species
    102477344 (ADCY9)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102477344 (ADCY9)
   04714 Thermogenesis
    102477344 (ADCY9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102477344 (ADCY9)
  09165 Substance dependence
   05032 Morphine addiction
    102477344 (ADCY9)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102477344 (ADCY9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102477344 (ADCY9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102477344 (ADCY9)
   05163 Human cytomegalovirus infection
    102477344 (ADCY9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102477344 (ADCY9)
Enzymes [BR:tup01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102477344 (ADCY9)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 DUF512 zf-C2HC_2 AC_N
Other DBs
NCBI-GeneID: 102477344
NCBI-ProteinID: XP_006140810
LinkDB
Position
Un
AA seq 1353 aa
MASPPHQQLLHHHSTEVSCDSSGDSNSVRVKINPKQLSSNSQPKHCKYSISSSCSSSGDS
GGLPRRVGGGGRLRRQRKLPQLFERASSRWWDPKFDSVNLEEACLERCFPQTQRRFRYAL
FYIGFACLLWSIYFAVHMRAKLIVMVAPALCFLAVCVGFFLFTFTKLYARHYAWTSLVLT
LLVFTLTLAAQFQVLTPLSGRVDSSNHTAAAKSTDTCLSQVGSFSMCIEVLFLLYTVMHL
PLYLSLFLGVAYSVLFETFGYHFRDEDCFPWPGARALHWELLGRALLHVCIHAIGVHLFI
MSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMRQGDEESENSVKR
HATSSPKNRKKKSSIQKTPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLN
DLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQEK
KEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLD
DRYEMEDGKVIERLGQSVVADQLKGLKTYLISGQRAKESHCSCAEALLSGFEAIGSSRVS
SGPRGQGTASSGSVSDLAQTVQTFDNLKTCPSCGITFAPKAEASAEGGAVQNGCPDERAN
STKASGGSNAKTQNGLLSPPQEEKLTSSQTSLCEILQEKGRWAGVSLDQSALLPLRFKNI
REKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDQELERSYRTSYQEEVVKNSPVKTF
ASATFSSLLDVFLSTTVFLILSVTCFLKYGATATPPPPAALAVFGAALLLELLSLAVSIR
MVFFLEDVMACTKRLLEWVAGWLPRHCIGAVLVSLPALAVYSHVTSEFERNVHVTVFTGS
AVLVAVVHYCNFCQLSSWMRSSLATVVGAGPLLLLYISLCPDSSIVMSPLDAVQNFSSGR
SPCDSSLLRADGRPATLIGQELILVFFPLLLLVWFLNREFEVSYRLHYHGDVEADLHRTK
IQSMRDQADWLLRNIIPYHVAEQLKVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGKE
CYRVLNELIGDFDELLSKPGYSSIEKIKTIGATYMAASGLNTAQRQDGSHPQEHLQVLFE
FAKEMMRVVDDFNNNMLWFNFKLRVGFHHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTT
GVECRIQVSEESFRVLSKMGYDFDYRGTVNVKGKGQMKTYLYPKCAGNGVVPQHQLSISP
DIRVQVDGSIGRSPTDEIASLVLAGQYSDKVSLGSASSTQAKDAHLASERAWREPASTEE
RCRLGKAAERNGCEEPGVDEADELTKLNVSKSV
NT seq 4062 nt   +upstreamnt  +downstreamnt
atggcctcccctccccaccagcagctgctgcatcaccacagcaccgaggtgagctgcgac
tccagcggggacagcaacagcgtgagggtcaagatcaaccccaagcagctgtcctccaac
agccagcccaagcactgcaagtacagcatctcttccagctgcagcagctccggggactcc
ggggggctcccccggagagtgggcggtgggggccgcctgcgcaggcagaggaagctgccc
cagcttttcgagagggcttccagcaggtggtgggaccccaagttcgactccgtgaacctg
gaggaggcctgcctggagcgctgcttcccgcagacccagcgccggttccgatacgcgctt
ttctacatcggcttcgcctgccttctctggagcatctattttgctgtccacatgagagcc
aaactgatcgtcatggttgccccggctctgtgcttcctagcggtatgcgtgggctttttt
ctgtttaccttcaccaagctgtatgcccggcactacgcctggacctcgctggttctcacc
ctgctggtgttcaccctaaccctggctgcgcagtttcaggttttgacgcctctctcagga
cgtgttgacagctccaatcacactgctgcagccaaatccacagacacttgcttatctcaa
gtggggagcttttccatgtgcattgaagtgctctttttgctctacaccgtcatgcactta
cccttgtacttgagtttgtttctgggggtggcctattcggttctctttgagacctttggc
taccatttccgagatgaagactgcttcccctggcctggagcccgggccctgcactgggag
ctgctgggcagggccctgctgcacgtctgcatccacgccatcggggtccacctcttcatc
atgtctcaggtgcggtccaggagcaccttcctcaaggtgggacagtcgatcatgcatggg
aaagacctagaagtagagaaagccctgaaagaaaggatgattcattctgtgatgccgaga
atcatagctgatgacctcatgagacagggggacgaggagagcgagaattctgtcaaaagg
catgccacctccagtcccaagaacaggaagaaaaagtcttccatacagaaaactcccatc
gcattccgccctttcaagatgcagcagattgaagaagtcagtattttatttgcagatatc
gtgggttttaccaagatgagtgccaacaagtctgctcacgccctggtgggtctcctgaat
gatctgtttggtcgctttgaccgcttgtgtgaagagaccaagtgtgagaagatcagcacc
ctgggagactgctactactgcgtggcaggctgtcccgagccccgggcagaccatgcctac
tgctgcatcgagatggggttaggcatgataaaggccattgagcagttctgccaggagaag
aaggaaatggtgaacatgcgtgttggggttcacacggggactgtcttgtgtggcattttg
ggaatgaggaggttcaaattcgacgtgtggtccaatgatgtgaacttggccaatctcatg
gagcagctgggagtagccggcaaagttcacatttccgaggccacagcaaaatacttagat
gaccggtacgaaatggaagatgggaaagttattgagcgccttggccagagtgtagttgct
gaccagttgaaaggtttgaagacatacctgatatcgggtcagagagccaaggagtctcac
tgcagctgtgcagaggccttgctttctggctttgaggccattggcagctcccgggtgtcc
tcaggccctaggggacaggggacagcatcatcagggagtgtcagtgacttggcgcagact
gtccaaacctttgataaccttaagacctgcccgtcgtgtggaatcacctttgctcccaaa
gctgaagccagtgcagaaggaggcgctgtccagaacggctgtccagacgagcgtgcgaac
agcaccaaggcttctggaggatctaatgccaaaactcagaatggccttctgagccctccc
caagaggagaagctcactagcagtcagacctcgctgtgtgagatcttacaggaaaagggg
aggtgggcaggggtcagcttggaccagtcggctctccttccgctgagattcaagaacatc
cgcgagaagaccgacgcccactttgtggatgtcatcaaagaagacagcctgatgaaagac
tacttttttaagccgcccattaaccagttcagcctgaacttcctggatcaggagctggag
cgatcctacaggaccagctatcaggaagaggtcgtgaagaactctcctgtgaagactttc
gccagtgccaccttcagctccctcctggacgtgttcctgtccacaacggtattcctcatc
ctgtctgtcacctgcttcctgaagtacggggccaccgccacgcctcccccgcccgccgcg
ctggccgtcttcggggcggccttgctgctggagctgctgtccctggccgtgtccatcagg
atggtgtttttcctggaagacgtgatggcttgcacgaagcgcctgctggagtgggtggcc
ggctggctcccacgccactgcatcggggccgtgctggtgtcactgcccgccctcgcagtc
tactctcacgtcacctccgagtttgagagaaacgtgcatgtcacggtgttcacgggctcc
gccgtgctggtggccgtcgtgcactactgcaacttctgccagctcagctcctggatgagg
tcgtccctcgccaccgtcgtgggggccgggccgctgctcctgctgtacatctccctgtgc
cccgacagttccatagtaatgtctcccctcgatgcagtacagaatttcagctccgggagg
agtccatgcgacagctcgttgctgcgggccgacggaagaccagccaccctcatcggccag
gagctgatcttggtcttcttcccgctgctcttgctggtctggttcctgaaccgcgagttc
gaggtcagctaccgccttcactaccacggggacgtggaggcggacctgcaccgcaccaag
atccagagcatgagggaccaggccgactggctgctcaggaacatcatcccctaccacgtg
gccgagcagctgaaggtgtcacagacctactccaagaaccacgacagcggcggcgtgatc
tttgccagcatcgtcaacttcagcgagttctacgaggagaactacgagggcggcaaggag
tgctaccgcgtcctcaacgagctgatcggggacttcgacgagctcctgagcaagccgggc
tacagcagcatcgagaagatcaagaccatcggggccacctacatggcggcgtcggggctg
aacacggcgcagcgccaggatggcagccacccgcaggagcacctgcaggtcctgttcgag
ttcgccaaggagatgatgcgcgtggtggacgacttcaacaacaacatgctgtggttcaac
ttcaagctcagagtgggcttccaccacgggcccctcacggcgggcgtcatcggcaccacc
aagctgctgtacgacatctggggggacacggtcaacatcgccagcaggatggacaccacc
ggcgtcgagtgccgcatccaggtgagcgaggagagcttccgcgtcttgagcaagatgggc
tatgacttcgactaccgggggacggtgaacgtcaaggggaagggccagatgaagacctac
ctttaccccaagtgcgcgggcaatggggtggtgccgcagcaccaactgtccatctccccc
gacatccgcgtgcaggtggacggcagcatcggacgctcgcccacagacgagatcgccagc
ctggtgctggccgggcagtactcggacaaggtgtccctgggctccgccagcagcactcag
gccaaggatgctcacctggcctctgagagagcctggagggagcccgccagcaccgaagag
aggtgccgacttggcaaagccgcagagagaaacggctgcgaggagccgggggtggacgaa
gccgatgaactcaccaagctcaatgtctcaaagagcgtgtga

KEGG   Tupaia chinensis (Chinese tree shrew): 102477532
Entry
102477532         CDS       T02978                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00230  Purine metabolism
tup01100  Metabolic pathways
tup01522  Endocrine resistance
tup04015  Rap1 signaling pathway
tup04020  Calcium signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04024  cAMP signaling pathway
tup04062  Chemokine signaling pathway
tup04072  Phospholipase D signaling pathway
tup04114  Oocyte meiosis
tup04211  Longevity regulating pathway
tup04213  Longevity regulating pathway - multiple species
tup04261  Adrenergic signaling in cardiomyocytes
tup04270  Vascular smooth muscle contraction
tup04371  Apelin signaling pathway
tup04540  Gap junction
tup04611  Platelet activation
tup04713  Circadian entrainment
tup04714  Thermogenesis
tup04723  Retrograde endocannabinoid signaling
tup04724  Glutamatergic synapse
tup04725  Cholinergic synapse
tup04727  GABAergic synapse
tup04740  Olfactory transduction
tup04750  Inflammatory mediator regulation of TRP channels
tup04911  Insulin secretion
tup04912  GnRH signaling pathway
tup04913  Ovarian steroidogenesis
tup04914  Progesterone-mediated oocyte maturation
tup04915  Estrogen signaling pathway
tup04916  Melanogenesis
tup04918  Thyroid hormone synthesis
tup04921  Oxytocin signaling pathway
tup04923  Regulation of lipolysis in adipocytes
tup04925  Aldosterone synthesis and secretion
tup04926  Relaxin signaling pathway
tup04927  Cortisol synthesis and secretion
tup04928  Parathyroid hormone synthesis, secretion and action
tup04934  Cushing syndrome
tup04935  Growth hormone synthesis, secretion and action
tup04962  Vasopressin-regulated water reabsorption
tup04970  Salivary secretion
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup04976  Bile secretion
tup05032  Morphine addiction
tup05163  Human cytomegalovirus infection
tup05166  Human T-cell leukemia virus 1 infection
tup05200  Pathways in cancer
tup05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102477532 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102477532 (ADCY3)
   04371 Apelin signaling pathway
    102477532 (ADCY3)
   04020 Calcium signaling pathway
    102477532 (ADCY3)
   04072 Phospholipase D signaling pathway
    102477532 (ADCY3)
   04024 cAMP signaling pathway
    102477532 (ADCY3)
   04022 cGMP-PKG signaling pathway
    102477532 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102477532 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102477532 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102477532 (ADCY3)
   04062 Chemokine signaling pathway
    102477532 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    102477532 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    102477532 (ADCY3)
   04912 GnRH signaling pathway
    102477532 (ADCY3)
   04913 Ovarian steroidogenesis
    102477532 (ADCY3)
   04915 Estrogen signaling pathway
    102477532 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    102477532 (ADCY3)
   04921 Oxytocin signaling pathway
    102477532 (ADCY3)
   04926 Relaxin signaling pathway
    102477532 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    102477532 (ADCY3)
   04918 Thyroid hormone synthesis
    102477532 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    102477532 (ADCY3)
   04916 Melanogenesis
    102477532 (ADCY3)
   04925 Aldosterone synthesis and secretion
    102477532 (ADCY3)
   04927 Cortisol synthesis and secretion
    102477532 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102477532 (ADCY3)
   04270 Vascular smooth muscle contraction
    102477532 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    102477532 (ADCY3)
   04971 Gastric acid secretion
    102477532 (ADCY3)
   04972 Pancreatic secretion
    102477532 (ADCY3)
   04976 Bile secretion
    102477532 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102477532 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    102477532 (ADCY3)
   04727 GABAergic synapse
    102477532 (ADCY3)
   04725 Cholinergic synapse
    102477532 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    102477532 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    102477532 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    102477532 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    102477532 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    102477532 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102477532 (ADCY3)
   04714 Thermogenesis
    102477532 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102477532 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    102477532 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102477532 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102477532 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102477532 (ADCY3)
   05163 Human cytomegalovirus infection
    102477532 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102477532 (ADCY3)
Enzymes [BR:tup01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102477532 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA NCE101 Peptidase_S49_N
Other DBs
NCBI-GeneID: 102477532
NCBI-ProteinID: XP_006147299
LinkDB
Position
Un
AA seq 1145 aa
MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDMLAPLAVAAVGLVLDIL
LFVLCKKGLLPDRVTRKVVPYLLWLLISAQIFSYLGLNFARAHAASDTVGWQAFFVFSFF
ITLPLSLSPIVLISVVSCVIHTLVLGVTVAQQQQDQLKGMQLLREILANVFLYLCAIIVG
VMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTLDCLKGEFDVEPGDGGSRCD
YLDEKGIETYLIIASKPEVKKTATQNGINGSALPNGVPTSSKPGSPALIETKEPNGSAQT
SGSTSEEPEEPDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCTAMVEILIDPWLMTN
YVTFAVGEILLLILTICSLAAIFPRAFPKKLVAFSTWIDHTRWARNTWAMLAIFILVMAN
VVDMLSCLQYYAGPSNGTAGVELEDGCLENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
LLVTGAVAAINLYAWCPVFDDYDHKRFQEHGFPVVALEKMQVLSPSGLNGTDRLPLVPSK
YSMTVMMFIMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEH
VARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDF
DSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSSKEEKSDKERWQHLADLADF
ALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGV
MGNIQVVEETQAILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKPAAFPNGSSITLPHQ
VVDNP
NT seq 3438 nt   +upstreamnt  +downstreamnt
atgccgaggaaccagggcttctcggagcccgagtactccgccgagtactccgccgagtac
tccgtcagcctgccctctgaccccgaccggggtgtgggccggacccatgagatctccgtg
cggaactcgggctcctgcctgtgcctgccccgcttcatgcggctgaccttcgtgcccgag
tccttggagaacctctaccagacctacttcaagaggcagcgccacgagaccttgctggtg
ctggtggtcttcgccgccctcttcgactgctacgtggtggtcatgtgcgccgtggtcttc
tccagcgacatgctggctcccctggccgtggccgccgtcgggctggtcttggacatcctc
ctcttcgtgctctgcaagaagggcctgctcccggaccgcgtcacccgcaaggtggtgccc
tacctgctgtggctgctcatctccgcgcagatcttctcttacctgggcctgaacttcgcc
cgcgcgcatgccgccagcgacacggtgggctggcaggccttctttgtcttctccttcttc
atcacgctgcccctcagcctcagccccatcgtcctcatctcggtggtctcctgtgtgatc
cacacgctggtcttgggagtcacggtggcccagcagcagcaggaccagctgaaggggatg
cagttgctaagagagatcctggccaacgtcttcctgtacctgtgtgccatcatcgtgggc
gtcatgtcctactacatggcggaccgcaagcaccgcaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaacctggaggagcagagccagcagcaggagaacctcatgctt
tccatcctgcccaagcacgtggccgacgagatgttgaaggacatgaagaaagacgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccgccacgagaacgtcagcatc
ctcttcgccgacatcgtgggcttcacgcagctgtcctctgcctgcagcgcccaggagctg
gtgaagctgctcaacgagctctttgcccgcttcgacaagctggcggccaaataccaccag
ctgcggatcaagatcctgggcgactgctactactgcatctgcggcctgcccgactaccgg
gaggaccacgccgtgtgctccatcctcatggggctcgccatggtcgaggccatctcgtat
gtgcgggagaagaccaagaccggtgtggacatgcgtgtgggggtgcacacgggcaccgtg
ctgggtggcgtcctgggccagaagcgctggcagtatgacgtgtggtctacggatgtcacc
gtggccaacaagatggaggctggcggcatccctgggcgcgtgcacatctcccagagcacc
ctggactgcctgaaaggagagttcgacgtggagccgggtgatgggggcagccgctgcgat
tacctagatgagaagggcattgaaacctacctcatcattgcctccaagccagaggtgaag
aaaaccgccacccaaaatggcatcaatggctcggccctgccaaatggagtaccaacttcc
tctaagcccggctcccctgccctcattgaaacgaaggagcccaacgggagtgcccaaacc
agtggctccacgtcggaggagcccgaggagccggatgcccaggccgacaacccctcgttc
cccaaccctcgccggaggctgcgccttcaggacctggcggaccgggtggtggatgcctct
gaggacgaacacgagctcaaccagctgctcaacgaggccctgcttgagcgagagtcggcc
caggtggtgaagaagagaaacaccttcctcctgtccatgcggttcatggaccccgagatg
gaaactcgctactcggtggagaaggaaaagcagagtggagccgccttcagctgctcctgc
gtcgtcctgctctgcacagccatggtggagatactcatcgacccctggctgatgacaaac
tatgtgaccttcgcggttggggagattctgctcctgattctgaccatctgctcactggct
gccatctttccccgggcctttcctaagaagcttgtggccttctcgacgtggatcgatcac
acccgctgggccaggaacacctgggccatgttagccatcttcattctggttatggcgaat
gtcgtggacatgctcagctgtctccagtactacgcgggacccagcaacgggacagcaggg
gtggagctggaggatggctgcctggagaaccccaagtactacaactatgtggctgtgctg
tcgctcatcgccaccatcatgctggtgcaggtcagccacatggtgaagctcacgctcatg
ctgcttgtcacgggcgctgtggctgccatcaacctctatgcctggtgccccgtctttgat
gactacgaccacaaacgttttcaggaacatggctttccagtggtggccttagagaagatg
caggtgttgtccccctctgggctcaatggcactgacaggctgcccctggtgccttccaag
tactcgatgacagtgatgatgttcatcatgatgctgagcttctactacttctcccgccac
gtggaaaaactggcacggacactgttcttgtggaagattgaggtccacgaccagaaggaa
cgtgtctatgagatgcgacgctggaacgaggccttggtcaccaacatgctacccgagcat
gtggctcgccatttcctggggtccaagaagagagatgaggagctgtacagccagtcttac
gacgagatcggagtcatgtttgcctccctgcccaactttgctgacttctacacggaggag
agcatcaacaacggtggcattgaatgtctgcgcttccttaatgagatcatctcagacttt
gactctctcctggataaccccaaattccgggtcatcaccaagatcaaaaccattggcagc
acctatatggcagcctcaggagtcaccccagatgtcaacactaacggatttaccagctcc
agcaaggaggaaaagtcagacaaggagcgctggcagcacctggccgacctggccgacttc
gcgctagccatgaaggatacgctcacaaacatcaacaatcagtccttcaacaacttcatg
ctgcgcataggcatgaacaaaggaggggtcctggctggtgtcattggagcccggaaacca
cactatgacatctggggcaacacagtcaacgtcgccagcaggatggagtctacaggggtc
atgggcaacattcaggttgtggaagagacacaagccatcctccgagagtatggcttccgc
tttgtgaggcgaggccccatctttgtgaaagggaagggggagctgctgaccttcttcctg
aaggggcgagataagcctgctgccttccccaatggctcctccatcacactgccccaccag
gttgtggacaacccctga

KEGG   Tupaia chinensis (Chinese tree shrew): 102490273
Entry
102490273         CDS       T02978                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00230  Purine metabolism
tup01100  Metabolic pathways
tup01522  Endocrine resistance
tup04015  Rap1 signaling pathway
tup04020  Calcium signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04024  cAMP signaling pathway
tup04062  Chemokine signaling pathway
tup04072  Phospholipase D signaling pathway
tup04114  Oocyte meiosis
tup04211  Longevity regulating pathway
tup04213  Longevity regulating pathway - multiple species
tup04261  Adrenergic signaling in cardiomyocytes
tup04270  Vascular smooth muscle contraction
tup04371  Apelin signaling pathway
tup04540  Gap junction
tup04611  Platelet activation
tup04713  Circadian entrainment
tup04714  Thermogenesis
tup04723  Retrograde endocannabinoid signaling
tup04724  Glutamatergic synapse
tup04725  Cholinergic synapse
tup04727  GABAergic synapse
tup04742  Taste transduction
tup04750  Inflammatory mediator regulation of TRP channels
tup04911  Insulin secretion
tup04912  GnRH signaling pathway
tup04913  Ovarian steroidogenesis
tup04914  Progesterone-mediated oocyte maturation
tup04915  Estrogen signaling pathway
tup04916  Melanogenesis
tup04918  Thyroid hormone synthesis
tup04921  Oxytocin signaling pathway
tup04923  Regulation of lipolysis in adipocytes
tup04925  Aldosterone synthesis and secretion
tup04926  Relaxin signaling pathway
tup04927  Cortisol synthesis and secretion
tup04928  Parathyroid hormone synthesis, secretion and action
tup04934  Cushing syndrome
tup04935  Growth hormone synthesis, secretion and action
tup04970  Salivary secretion
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup04976  Bile secretion
tup05032  Morphine addiction
tup05163  Human cytomegalovirus infection
tup05166  Human T-cell leukemia virus 1 infection
tup05200  Pathways in cancer
tup05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102490273 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102490273 (ADCY4)
   04371 Apelin signaling pathway
    102490273 (ADCY4)
   04020 Calcium signaling pathway
    102490273 (ADCY4)
   04072 Phospholipase D signaling pathway
    102490273 (ADCY4)
   04024 cAMP signaling pathway
    102490273 (ADCY4)
   04022 cGMP-PKG signaling pathway
    102490273 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102490273 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102490273 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102490273 (ADCY4)
   04062 Chemokine signaling pathway
    102490273 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    102490273 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    102490273 (ADCY4)
   04912 GnRH signaling pathway
    102490273 (ADCY4)
   04913 Ovarian steroidogenesis
    102490273 (ADCY4)
   04915 Estrogen signaling pathway
    102490273 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    102490273 (ADCY4)
   04921 Oxytocin signaling pathway
    102490273 (ADCY4)
   04926 Relaxin signaling pathway
    102490273 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    102490273 (ADCY4)
   04918 Thyroid hormone synthesis
    102490273 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    102490273 (ADCY4)
   04916 Melanogenesis
    102490273 (ADCY4)
   04925 Aldosterone synthesis and secretion
    102490273 (ADCY4)
   04927 Cortisol synthesis and secretion
    102490273 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102490273 (ADCY4)
   04270 Vascular smooth muscle contraction
    102490273 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    102490273 (ADCY4)
   04971 Gastric acid secretion
    102490273 (ADCY4)
   04972 Pancreatic secretion
    102490273 (ADCY4)
   04976 Bile secretion
    102490273 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    102490273 (ADCY4)
   04727 GABAergic synapse
    102490273 (ADCY4)
   04725 Cholinergic synapse
    102490273 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    102490273 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    102490273 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    102490273 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    102490273 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    102490273 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102490273 (ADCY4)
   04714 Thermogenesis
    102490273 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102490273 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    102490273 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102490273 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102490273 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102490273 (ADCY4)
   05163 Human cytomegalovirus infection
    102490273 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102490273 (ADCY4)
Enzymes [BR:tup01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102490273 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 102490273
NCBI-ProteinID: XP_006144671
LinkDB
Position
Un
AA seq 1118 aa
MAPQSSTRTCSHPRAAVRTGLDPWDAAAAAVGKRERLRSETFAGQLPSLGLRERSQGLRP
LAAIWEWAERPQGVLEGDRIAARRGAPGRKGEQQELTSDSGFLATVVCALGGFSLLLVLA
SREQRLQRWTRPLSGLVWAALLALGHGFLFTGGVVSAWDQVSFFLFIIFTVYAMLPLGMR
EATAAGLASSLSHLLALGLYLGPQPDSRPALLPQLAANAVLFLCGNVAGAYHKALMERAL
RATFREALSSLHSRRRLDTEKRHQEHLLLSILPAYLAQEMKAEIMARLQAGQGSRPESTN
NFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNELFGKFDQIAKEHECMRIKI
LGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATGVDINMRVGVHSGSVLCGVI
GLQKWQYDVWSHDVTLANHMEAGGVPGRVHITRATLALLAGAYAVEDTAMEHRDPYLREL
GEPTYLVIDPRAEEEDEKGTAGGLLSSLEGPKMRPSLLMTRYLESWGAAKPFAHLSHVDS
PVSTSTPLPEKALASFSPQWSLDRSRTPRGLDDELDTGDAKFFQVIEQLNSQKQWKQSKD
FNPVTLYFRKKEMEKEYRLSALPAFKYYAACTFLVFLSNFIVQMLVTNRPPALAITYCVT
FLLFLLLLFVCFSEHLTRCVLKGPKILHWLPTLSSLVATRPGLRVALGTATILLVFAMAI
TSLFFLPASSDCPFWAPNVSSMAFNLSWELPGSLPLISVPYSMHCCVLAFLSCSLFLHMS
FELKLLLLLLWLVTSCSLFLHSHAWLSDCLVARLYLGPLDSRPGVLKEPKLMGAVSFFIF
FFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRLLLENVLPAHVAPQFIGQNR
RNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLRLLNEIIADFDELLSKPKFS
GVEKIKTIGSTYMAATGLNATSGQEAQQDTERSCSHLGTMVEFAVALGSKLDVINKHSFN
NFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMESTGVLGKIQVTEETARALQSL
GYTCYSRGVIKVKGKGQLCTYFLNTDLTRAGPPSAALG
NT seq 3357 nt   +upstreamnt  +downstreamnt
atggccccacagagctccacgcggacatgctcccacccacgagctgccgtccgcacgggc
ttggacccttgggacgctgccgcagcggctgtcggcaagagggagaggctgcgaagtgag
acctttgctgggcagctccccagtctaggtttgagggagaggagccaaggactgaggccc
ctggccgccatctgggagtgggctgagaggccgcagggagtccttgaaggagaccggatt
gcagcgcgtcggggggcgccgggcaggaagggcgagcagcaggagctgacctcagactcg
ggcttcctggccaccgtcgtgtgtgcactgggcggcttctcactgctattggtcctcgct
tcccgcgagcagcgactgcagcgctggacacggccactctcgggactcgtgtgggccgcg
ctgctcgcattaggccatggctttctgttcaccgggggtgttgtcagcgcctgggaccag
gtgtcttttttcctcttcatcatcttcactgtgtatgccatgttgcccttgggcatgcgg
gaagccaccgctgcaggcctcgcctcctccctgtcgcacctgctggccctcgggctgtac
cttgggccgcagccagactcaaggccagcgctgctgccacagctcgcagcaaacgcggtg
ttgttcctgtgcgggaacgtggcgggagcataccacaaggcgttaatggagcgagcgctg
cgggccacgttcagggaggcactcagctctctgcactcgcgaaggcggctggacactgag
aagaggcaccaggaacaccttctcttgtccatccttcctgcctacctggcccaagagatg
aaggcagagatcatggctcggctgcaggctggacaagggtcccggccagagagcaccaac
aacttccacagcctctatgtcaagaggcaccagggagtcagtgtgctgtatgctgacatc
gtgggcttcacccggctggccagcgagtgctcccctaaggagctggtgctcatgctcaat
gagctttttggcaagttcgaccagatcgccaaggagcacgaatgcatgcggatcaagatc
ctgggggactgttactactgtgtctctgggctgcccctgtcactaccagaccacgccatt
aactgtgtacgcatggggctggacatgtgccgagccatcaggaaactgcgggcagccact
ggtgtggacatcaacatgcgtgtgggggtgcactcaggcagcgtgctctgcggagtcatc
gggctgcagaagtggcagtacgatgtgtggtcccacgacgtcacactggccaaccacatg
gaggcgggtggcgtgccagggcgagtgcacatcacaagggctaccctggccctcctagca
ggggcgtatgctgtggaggataccgccatggaacaccgggacccctaccttcgggagcta
ggggaacctacctatctggtcatcgatccccgggctgaggaggaggatgagaagggcacc
gcagggggattgctgtcctctcttgagggccccaagatgcgtccatcactgctgatgacc
cgctacctggagtcctggggtgcagccaagccttttgcccacctgagccacgtagacagc
cctgtgtccacctctacccctcttccggagaaggccctggcttccttcagtccccagtgg
agcctggaccggagccgaactcccaggggactggatgatgagctggacactggggatgcc
aagttcttccaggtcatcgaacagctcaactctcagaaacagtggaagcagtccaaggat
ttcaacccagtgacactgtacttccgaaagaaggagatggagaaagagtatcgactttcg
gcacttcctgccttcaaatactatgcagcctgcactttcctggtttttctctccaacttc
attgtccagatgctggtgacaaacaggcccccagctctggccatcacctattgcgtcacc
ttcctcttgttcctcctcctgctcttcgtgtgcttctcagagcacctgacgaggtgtgtc
ctgaaaggccccaagatactacactggcttcccacactgtccagcctggtggccacaagg
cccggactgcgagtggccctgggtactgctaccatcctcctcgtctttgccatggccatt
accagcttgttcttcttaccagcatcatcggactgccctttctgggctcccaatgtgtcc
tccatggctttcaacctgtcctgggagctccctgggtccctgcctctcatcagtgtccca
tactccatgcactgctgcgtgctggccttcctctcctgctccctctttctgcacatgagc
ttcgaactgaagctgctgctgctcctgctatggctggtgacgtcctgttccctcttcctg
cactcccatgcctggctgtctgactgcctcgtcgcccgcctctatctggggcccctagac
tccaggccaggagtactgaaggagccaaaactgatgggagctgtctccttcttcatcttc
ttcttcaccctccttgtcctagctcggcagaatgagtattattgccgcttggacttcctg
tggaaaaagaagctgaggcaagagcgggaggagacagagacgatggagaacctgacccgg
ctactcttggagaatgtgctccctgcccacgtggccccccagttcattggccagaaccgg
cgcaatgaggacctctaccatcagtcctacgagtgtgtttgtgtcctgtttgcctcagtc
ccggacttcaaagagttttactctgaatccaacatcaaccatgaggggctagagtgtctg
cggctgcttaatgagatcattgctgactttgatgagctgctctccaagcccaagttcagt
ggagtggagaagatcaaaaccattggcagcacctacatggcagccacaggcttaaatgcc
acctctggacaggaggcacaacaggatactgagcgaagctgcagccaccttggcaccatg
gtggaatttgcggtggccctggggtctaagctggatgtcatcaacaagcactcgttcaac
aacttccgtctgcgtgtggggttgaatcacggaccagttgtggccggagtgattggggct
caaaagccacaatacgacatttggggcaacacggtgaatgtggccagccgcatggagagt
acaggagtccttggcaagatccaagtgacggaagagacagctcgggccctgcagtccttg
ggctacacctgctacagccggggtgtcatcaaggtcaaaggcaaaggccagctctgcacc
tactttctaaacacagacttgacacgagctggacctccttcagctgccctcggctga

KEGG   Tupaia chinensis (Chinese tree shrew): 102490639
Entry
102490639         CDS       T02978                                 

Gene name
ADCY5
Definition
(RefSeq) adenylate cyclase 5
  KO
K08045  adenylate cyclase 5 [EC:4.6.1.1]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00230  Purine metabolism
tup01100  Metabolic pathways
tup01522  Endocrine resistance
tup04015  Rap1 signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04024  cAMP signaling pathway
tup04062  Chemokine signaling pathway
tup04072  Phospholipase D signaling pathway
tup04114  Oocyte meiosis
tup04211  Longevity regulating pathway
tup04213  Longevity regulating pathway - multiple species
tup04261  Adrenergic signaling in cardiomyocytes
tup04270  Vascular smooth muscle contraction
tup04371  Apelin signaling pathway
tup04540  Gap junction
tup04611  Platelet activation
tup04713  Circadian entrainment
tup04714  Thermogenesis
tup04723  Retrograde endocannabinoid signaling
tup04724  Glutamatergic synapse
tup04725  Cholinergic synapse
tup04726  Serotonergic synapse
tup04727  GABAergic synapse
tup04728  Dopaminergic synapse
tup04750  Inflammatory mediator regulation of TRP channels
tup04911  Insulin secretion
tup04912  GnRH signaling pathway
tup04913  Ovarian steroidogenesis
tup04914  Progesterone-mediated oocyte maturation
tup04915  Estrogen signaling pathway
tup04916  Melanogenesis
tup04918  Thyroid hormone synthesis
tup04921  Oxytocin signaling pathway
tup04923  Regulation of lipolysis in adipocytes
tup04924  Renin secretion
tup04925  Aldosterone synthesis and secretion
tup04926  Relaxin signaling pathway
tup04927  Cortisol synthesis and secretion
tup04928  Parathyroid hormone synthesis, secretion and action
tup04934  Cushing syndrome
tup04935  Growth hormone synthesis, secretion and action
tup04970  Salivary secretion
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup04976  Bile secretion
tup05012  Parkinson disease
tup05030  Cocaine addiction
tup05031  Amphetamine addiction
tup05032  Morphine addiction
tup05034  Alcoholism
tup05163  Human cytomegalovirus infection
tup05166  Human T-cell leukemia virus 1 infection
tup05200  Pathways in cancer
tup05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102490639 (ADCY5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102490639 (ADCY5)
   04371 Apelin signaling pathway
    102490639 (ADCY5)
   04072 Phospholipase D signaling pathway
    102490639 (ADCY5)
   04024 cAMP signaling pathway
    102490639 (ADCY5)
   04022 cGMP-PKG signaling pathway
    102490639 (ADCY5)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102490639 (ADCY5)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102490639 (ADCY5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102490639 (ADCY5)
   04062 Chemokine signaling pathway
    102490639 (ADCY5)
  09152 Endocrine system
   04911 Insulin secretion
    102490639 (ADCY5)
   04923 Regulation of lipolysis in adipocytes
    102490639 (ADCY5)
   04912 GnRH signaling pathway
    102490639 (ADCY5)
   04913 Ovarian steroidogenesis
    102490639 (ADCY5)
   04915 Estrogen signaling pathway
    102490639 (ADCY5)
   04914 Progesterone-mediated oocyte maturation
    102490639 (ADCY5)
   04921 Oxytocin signaling pathway
    102490639 (ADCY5)
   04926 Relaxin signaling pathway
    102490639 (ADCY5)
   04935 Growth hormone synthesis, secretion and action
    102490639 (ADCY5)
   04918 Thyroid hormone synthesis
    102490639 (ADCY5)
   04928 Parathyroid hormone synthesis, secretion and action
    102490639 (ADCY5)
   04916 Melanogenesis
    102490639 (ADCY5)
   04924 Renin secretion
    102490639 (ADCY5)
   04925 Aldosterone synthesis and secretion
    102490639 (ADCY5)
   04927 Cortisol synthesis and secretion
    102490639 (ADCY5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102490639 (ADCY5)
   04270 Vascular smooth muscle contraction
    102490639 (ADCY5)
  09154 Digestive system
   04970 Salivary secretion
    102490639 (ADCY5)
   04971 Gastric acid secretion
    102490639 (ADCY5)
   04972 Pancreatic secretion
    102490639 (ADCY5)
   04976 Bile secretion
    102490639 (ADCY5)
  09156 Nervous system
   04724 Glutamatergic synapse
    102490639 (ADCY5)
   04727 GABAergic synapse
    102490639 (ADCY5)
   04725 Cholinergic synapse
    102490639 (ADCY5)
   04728 Dopaminergic synapse
    102490639 (ADCY5)
   04726 Serotonergic synapse
    102490639 (ADCY5)
   04723 Retrograde endocannabinoid signaling
    102490639 (ADCY5)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102490639 (ADCY5)
  09149 Aging
   04211 Longevity regulating pathway
    102490639 (ADCY5)
   04213 Longevity regulating pathway - multiple species
    102490639 (ADCY5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102490639 (ADCY5)
   04714 Thermogenesis
    102490639 (ADCY5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102490639 (ADCY5)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102490639 (ADCY5)
  09165 Substance dependence
   05030 Cocaine addiction
    102490639 (ADCY5)
   05031 Amphetamine addiction
    102490639 (ADCY5)
   05032 Morphine addiction
    102490639 (ADCY5)
   05034 Alcoholism
    102490639 (ADCY5)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102490639 (ADCY5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102490639 (ADCY5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102490639 (ADCY5)
   05163 Human cytomegalovirus infection
    102490639 (ADCY5)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102490639 (ADCY5)
Enzymes [BR:tup01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102490639 (ADCY5)
SSDB
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA DUF2339 TBK1_ULD
Other DBs
NCBI-GeneID: 102490639
NCBI-ProteinID: XP_006154659
LinkDB
Position
Un
AA seq 1088 aa
MPRCCAGPGAAPDCGDGGSSTGSGAGPGAVLSLGACCLALLQIFRSKKFPSDKLERLYQR
YFFRLNQSSLTMLMAVLVLVCLVMLAFHAARPPLQLPYLAVLAAAVGVILVMAVLCNRAA
FHQDHMGLACYALIAVVLAVQVVGLLLPQPRSASEGIWWTVFFIYTIYTLLPVRMRAAVL
SGVLLSALHLAISLRTNAQDQFLLKQLVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQETR
ECIQARLHSQRENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILF
ADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARAD
HAHCCVEMGMDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLA
NHMEAGGKAGRIHITKATLNYLNGDYEVEPGCGGERNAYLKEHSIETFLILRCTQKRKEE
KAMIAKMNRQRTNSIGHNPPPWGAERPFYNHLGGNQVSKEMKRMGFEDPKDNWFSVCFPE
DEVDEFLGRAIDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRFGAYVACASLVFL
FICFVQITIVPHSVFMLSVYLTCFLLLALVVSVSVIYSCVKLFPTPLQTLSRKIVRSKMN
STLVGVFTITLVFLSAFVNMFMCNSTDLLGCLAEEHNLSVSQVNACHVVESVVNYSLGEE
RGFCGSSWPNCNFPEYFTYSVLLSLLACSVFLQISCIGKLVLMLAIELIYVLVVEVPGVT
LFDNADLLVTANAIDFNNNGTSQCPEHATKVALKVVTPIIISVFVLALYLHAQQVESTAR
LDFLWKLQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVM
FASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEDRFKQLEKIKTIGSTYMAAS
GLNDSTYDKVGKTHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARK
PQYDIWGNTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYF
LNGGPPLS
NT seq 3267 nt   +upstreamnt  +downstreamnt
atgccccgctgctgcgcagggcccggggccgcccccgactgcggggatggcggcagttcc
actggctcaggcgcgggacccggcgcggtgctgtccctgggtgcctgctgcctggcgttg
ctgcagatattccgctccaagaagttcccgtcggacaagctggagcggctgtaccagcgc
tatttcttccgcctgaaccagagcagcctcaccatgctcatggccgtgctggtgctcgtg
tgcctcgtcatgttggcctttcacgcggcgcggcccccgctgcagctgccctacctggcg
gtgctggcggctgccgtgggtgtgatcctcgtcatggccgtgctctgcaaccgcgccgcc
tttcaccaggaccacatgggcctggcctgctatgcgctcatcgccgtggtgctggccgtc
caggtggtgggcctgctgctgccccagccgcgcagcgcttccgagggcatctggtggacc
gtgttcttcatctacaccatctacacgctgctgcccgtgcgcatgcgggccgcagtgctc
agcggggtgctcctgtctgccctccacctggccatctccctgcgcaccaacgcccaggac
cagttcctgctcaagcagcttgtctccaacgtcctcatcttctcctgcaccaacatcgtg
ggcgtctgcacccactaccctgccgaagtctcccagagacaggccttccaggagacccgg
gaatgcatccaggcaagactccactcacagcgggagaaccagcagcaggagcggctcctg
ctgtctgtccttccccgtcacgttgccatggagatgaaagcagacatcaacgccaagcag
gaggatatgatgttccataagatttacatccagaagcatgacaacgtgagcatcctgttc
gctgacatcgagggcttcaccagcctggcatcccagtgcactgctcaggaattggtcatg
accctcaacgagctcttcgcccgcttcgacaagctggcagcggagaatcactgtttacgt
attaagatcctgggggactgttattactgtgtctcggggctgcctgaagccagggctgac
cacgcccactgctgcgtggagatgggcatggacatgatcgaggccatctcgttggtccgg
gaggtgacaggggtgaacgtgaacatgcgcgtgggaattcacagcgggcgagtacactgc
ggtgtccttggtctcaggaagtggcagttcgacgtctggtctaacgacgtcacactggcc
aaccacatggaggccggcggcaaagcaggacgcatccacatcaccaaggccacactcaac
tacctgaacggcgactacgaggtggagcccggctgcgggggtgagcgcaacgcctacctc
aaggagcacagcattgagaccttcctcatcctgcgctgcacccagaagcggaaagaagag
aaggccatgatcgccaagatgaaccgccagaggaccaactccattgggcacaacccacca
ccctggggcgccgagcgccccttctacaaccacctgggcggcaaccaggtgtcaaaggag
atgaagcgcatgggttttgaagaccccaaggacaactggttttctgtctgtttccccgag
gatgaagtggatgagtttctgggccgggccatcgatgccaggagcattgacaggctgcga
tctgagcacgtccgcaaattcctcctgaccttcagggagcctgacttagagaagaagtac
tccaagcaggtggatgaccgattcggtgcctacgtggcgtgtgcctcgctcgtcttcctc
ttcatctgctttgtccagatcaccatcgtgccccactccgtgttcatgctgagtgtctat
ctgacctgcttcctgctgctggccctggtggtgtccgtgtctgtcatctactcctgcgtg
aagctcttccccaccccactgcagaccctctccaggaagattgtgcggtccaagatgaac
agcaccctggttggggtcttcaccatcaccctggtgttcctgtcggcctttgtcaacatg
ttcatgtgcaactccacggacctgctgggctgcctcgcagaggagcacaacctcagcgtg
agccaggtcaacgcgtgccacgtggtggagtcggtggtcaactacagcctgggcgaggag
cggggcttctgtggcagctcctggcccaactgcaacttccctgagtacttcacctacagc
gtgctgctcagcctgctggcctgctccgtgttcctgcagatcagctgcatcgggaagctg
gtgctcatgctggccatcgagctcatttacgtgctagtcgttgaagtgcccggcgtcacg
ctcttcgataacgccgacctgctggtcaccgccaatgccatagacttcaacaacaacggg
acctcccagtgccctgagcatgcgaccaaggtggcgctgaaggtggtgacgcccatcatc
atctcggtctttgtgctggccctgtacctgcatgcccagcaggtggagtccactgcccgc
ctcgacttcctctggaaactgcaggccacggaggagaaggaggagatggaggagctgcag
gcctacaaccggcgcctgctgcacaacatcctgcccaaggacgtggccgcccacttcctg
gcccgcgagcggcgcaacgacgagctgtactaccagtcctgcgagtgcgtggccgtcatg
ttcgcctccatcgccaacttctccgagttctacgtggagctggaggccaacaacgagggc
gttgagtgcctgcggctgctcaacgagatcatcgccgacttcgatgagatcatcagtgag
gatcggttcaagcagctggagaagatcaagaccattggcagcacctacatggccgcctcg
ggcctcaacgactccacctacgacaaggtgggcaagacccacatcaaggctctggccgac
tttgccatgaagctgatggaccagatgaagtacatcaacgagcactccttcaacaacttc
cagatgaagatcgggctcaacatcggccctgtggtggccggggtgattggggcccgcaag
ccccagtacgacatctggggcaataccgtgaacgtggccagccgcatggacagcactggt
gtgcccgaccgtatccaggtcaccacggacatgtaccaggtgctggctgccaacacatac
cagctggagtgccgaggcgtggtcaaagtcaagggcaagggcgagatgatgacctacttc
ctcaatggagggcccccgctcagttag

KEGG   Tupaia chinensis (Chinese tree shrew): 102492353
Entry
102492353         CDS       T02978                                 

Gene name
ADCY2
Definition
(RefSeq) adenylate cyclase 2
  KO
K08042  adenylate cyclase 2 [EC:4.6.1.1]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00230  Purine metabolism
tup01100  Metabolic pathways
tup01522  Endocrine resistance
tup04015  Rap1 signaling pathway
tup04020  Calcium signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04024  cAMP signaling pathway
tup04062  Chemokine signaling pathway
tup04072  Phospholipase D signaling pathway
tup04114  Oocyte meiosis
tup04211  Longevity regulating pathway
tup04213  Longevity regulating pathway - multiple species
tup04261  Adrenergic signaling in cardiomyocytes
tup04270  Vascular smooth muscle contraction
tup04371  Apelin signaling pathway
tup04540  Gap junction
tup04611  Platelet activation
tup04713  Circadian entrainment
tup04714  Thermogenesis
tup04723  Retrograde endocannabinoid signaling
tup04724  Glutamatergic synapse
tup04725  Cholinergic synapse
tup04727  GABAergic synapse
tup04750  Inflammatory mediator regulation of TRP channels
tup04911  Insulin secretion
tup04912  GnRH signaling pathway
tup04913  Ovarian steroidogenesis
tup04914  Progesterone-mediated oocyte maturation
tup04915  Estrogen signaling pathway
tup04916  Melanogenesis
tup04918  Thyroid hormone synthesis
tup04921  Oxytocin signaling pathway
tup04922  Glucagon signaling pathway
tup04923  Regulation of lipolysis in adipocytes
tup04925  Aldosterone synthesis and secretion
tup04926  Relaxin signaling pathway
tup04927  Cortisol synthesis and secretion
tup04928  Parathyroid hormone synthesis, secretion and action
tup04934  Cushing syndrome
tup04935  Growth hormone synthesis, secretion and action
tup04970  Salivary secretion
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup04976  Bile secretion
tup05032  Morphine addiction
tup05163  Human cytomegalovirus infection
tup05166  Human T-cell leukemia virus 1 infection
tup05200  Pathways in cancer
tup05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102492353 (ADCY2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102492353 (ADCY2)
   04371 Apelin signaling pathway
    102492353 (ADCY2)
   04020 Calcium signaling pathway
    102492353 (ADCY2)
   04072 Phospholipase D signaling pathway
    102492353 (ADCY2)
   04024 cAMP signaling pathway
    102492353 (ADCY2)
   04022 cGMP-PKG signaling pathway
    102492353 (ADCY2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102492353 (ADCY2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102492353 (ADCY2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102492353 (ADCY2)
   04062 Chemokine signaling pathway
    102492353 (ADCY2)
  09152 Endocrine system
   04911 Insulin secretion
    102492353 (ADCY2)
   04922 Glucagon signaling pathway
    102492353 (ADCY2)
   04923 Regulation of lipolysis in adipocytes
    102492353 (ADCY2)
   04912 GnRH signaling pathway
    102492353 (ADCY2)
   04913 Ovarian steroidogenesis
    102492353 (ADCY2)
   04915 Estrogen signaling pathway
    102492353 (ADCY2)
   04914 Progesterone-mediated oocyte maturation
    102492353 (ADCY2)
   04921 Oxytocin signaling pathway
    102492353 (ADCY2)
   04926 Relaxin signaling pathway
    102492353 (ADCY2)
   04935 Growth hormone synthesis, secretion and action
    102492353 (ADCY2)
   04918 Thyroid hormone synthesis
    102492353 (ADCY2)
   04928 Parathyroid hormone synthesis, secretion and action
    102492353 (ADCY2)
   04916 Melanogenesis
    102492353 (ADCY2)
   04925 Aldosterone synthesis and secretion
    102492353 (ADCY2)
   04927 Cortisol synthesis and secretion
    102492353 (ADCY2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102492353 (ADCY2)
   04270 Vascular smooth muscle contraction
    102492353 (ADCY2)
  09154 Digestive system
   04970 Salivary secretion
    102492353 (ADCY2)
   04971 Gastric acid secretion
    102492353 (ADCY2)
   04972 Pancreatic secretion
    102492353 (ADCY2)
   04976 Bile secretion
    102492353 (ADCY2)
  09156 Nervous system
   04724 Glutamatergic synapse
    102492353 (ADCY2)
   04727 GABAergic synapse
    102492353 (ADCY2)
   04725 Cholinergic synapse
    102492353 (ADCY2)
   04723 Retrograde endocannabinoid signaling
    102492353 (ADCY2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102492353 (ADCY2)
  09149 Aging
   04211 Longevity regulating pathway
    102492353 (ADCY2)
   04213 Longevity regulating pathway - multiple species
    102492353 (ADCY2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102492353 (ADCY2)
   04714 Thermogenesis
    102492353 (ADCY2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102492353 (ADCY2)
  09165 Substance dependence
   05032 Morphine addiction
    102492353 (ADCY2)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102492353 (ADCY2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102492353 (ADCY2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102492353 (ADCY2)
   05163 Human cytomegalovirus infection
    102492353 (ADCY2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102492353 (ADCY2)
Enzymes [BR:tup01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102492353 (ADCY2)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N HNOBA
Other DBs
NCBI-GeneID: 102492353
NCBI-ProteinID: XP_014441329
LinkDB
Position
Un
AA seq 1026 aa
MSLKKEVEDHVAFLITVPTALAIFFAIFILVCIESVFKKLLRLFSLVIWMCLVAMGYLFM
CFGGTVSPWDQVSFFLFIIFVVYTMLPFNMRDAIIASVLTSSSHTIVLSVCLSASPGAKE
HLVWQILANVIIFICGNLAGAYHKHLMELALQQTYQDTCNCIKSRIKLEFEKRQQERLLL
SLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHNLYVKRHTNVSILYADIVGFTRLASD
CSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLPNHAKNCVKMGLDM
CEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRV
HISSVTLEHLNGAYKVEEGDGDIRDPYLKQHLVKTYFVINPKGERRSPQHLFRPRHTLDG
AKMRASVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTTDVPMGQHNFQNRTLRTKSQ
KKRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLLFYNKILEKEYRATALPAFKYYVT
CACLIFFCIFIVQILVLPKTSVLGISFGAAFLSLAFILFVCFAGQLLQCSKKASASLMWL
LKSSGIIANRPWPRISLTVITTAIILTMAVFNMFFLSDSEEIVLPTANASNMSSSASSSQ
AAILRAQNLFFLPYFIYSCILGLISCSVFLRVNYELKMLIMMVALVGYNTILLHTHAHVL
DDYSQVLFERPGIWKDLKTMGSVSLSIFFITLLVLGRQNEYYCRLDFLWKNKFKKEREEI
ETMENLNRVLLENVLPAHVAEHFLARSLKNEELYHQSYDCVCVMFASIPDFKEFYTESDV
NKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAVPSQEYAQEPER
QYMHIGTMVEFAFALVAKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDIWGNTV
NVASRMDSTGVLDKIQVTEETSLILQTLGYTCTCRGIINVKGKGDLKTYFVNTEMSRSLS
QSNVAS
NT seq 3081 nt   +upstreamnt  +downstreamnt
atgagtcttaaaaaggaagtggaagaccatgtggcatttttaatcactgttccgactgcc
ctggcaattttcttcgcaatattcatcctcgtctgcatcgagtctgtgtttaagaagctg
ctccgactcttctctctggtgatatggatgtgcctcgtcgccatgggatacctgttcatg
tgcttcggaggcaccgtttctccctgggaccaggtctcattcttcctctttatcatcttc
gtggtgtacactatgctgcccttcaacatgcgagatgccatcatcgccagcgtcctcacc
tcctcttcccacaccatcgtgctgagcgtctgcctgtctgcgtctccaggagccaaggag
cacctggtttggcagatcctggccaatgtgatcatcttcatctgtgggaacctggcagga
gcctaccataagcacctcatggaacttgctctgcagcagacgtatcaggacacgtgtaac
tgcatcaagtcccggatcaagttggaatttgaaaaacgtcagcaggagcggctcctgctg
tccttgctgccggctcacatcgccatggagatgaaggcagagatcatccagaggctgcag
ggccccaaggccggccagatggagaacacaaacaacttccacaacctatacgtcaagcgc
cacaccaacgtgagtatcttatacgcggacatcgttggattcacccggctggcgagtgac
tgttccccaggagaactggtccacatgctaaacgagctcttcgggaagtttgatcaaatt
gctaaggagaatgagtgcatgagaattaaaattttaggagactgctactactgtgtgtcc
ggactccctatttctctccccaaccatgccaagaactgtgtgaaaatggggctggacatg
tgcgaagccataaagaaagtgcgagatgccaccggagttgacatcaacatgcgtgtgggc
gtgcactctgggaatgtactgtgcggtgtgattggtctgcagaagtggcagtatgatgtg
tggtcacatgacgtgaccctggccaaccacatggaagctggaggggtccccggacgtgtt
cacatttcttcagtcaccctggaacacttgaatggagcttacaaagtcgaggagggagat
ggtgacatcagggatccatacttaaaacagcacctggtgaaaacttacttcgtaatcaat
cccaagggagaacggcggagtcctcagcacctcttcaggcctcgccacaccctggatgga
gccaagatgagggcttcggtccgcatgacccggtacttggagtcctggggggcagccaag
cccttcgcacacttgcatcacagggacagcatgaccacggagaacggcaagatcagcacc
acggatgtaccaatgggtcaacataattttcaaaatcgcaccttaagaaccaagtcacag
aagaaaagatttgaagaagagttgaatgaaagaatgattcaagccattgatggaatcaac
gcacaaaagcaatggctcaagtctgaagacattcagaggatctcactgcttttctataac
aaaatactagaaaaagaataccgagccactgcactgccagcattcaagtactacgtgact
tgcgcgtgtctcatattcttctgcatcttcatcgtgcagatcctcgtcctgccaaagacg
tccgtcctggggatttccttcggagctgcgtttctctcgctggcctttatcctgtttgtc
tgctttgctggacagcttttgcaatgcagcaaaaaggcctctgcctcactcatgtggctt
ctgaagtcttcaggcatcatcgcaaaccggccctggccccggatctccctcacggtcatc
accacggccatcatcttaaccatggctgtgttcaacatgtttttcctgagcgactcagag
gaaatcgtccttccaactgctaatgcgtcaaacatgagctcttctgcctcgagtagccag
gcggcaatcctgcgtgcacaaaatctgtttttccttccgtacttcatatacagctgcatc
ctgggattaatatcctgttccgtcttcctgcgggtgaactacgagttgaaaatgctgatt
atgatggtggcactggtgggctacaacaccatcctgctccacacccacgcccacgtcctg
gacgactacagccaggtcttgttcgagaggccaggtatttggaaagacctaaagaccatg
ggatctgtgtcactctcgatatttttcatcacgctgcttgttctcggtagacagaatgaa
tattactgtaggttagacttcttatggaagaacaagttcaaaaaagagcgggaggagata
gagacgatggagaacctgaaccgcgtgctgctggagaacgtgcttcctgcgcacgtggcg
gagcacttcctggccaggagcctgaagaacgaggagttataccaccagtcatacgactgc
gtgtgcgtcatgtttgcctccattcccgacttcaaagagttttacacggaatcagatgtg
aacaaggagggcctggaatgccttcgacttctgaacgagatcatcgctgactttgatgat
ctgctgtccaagccgaagttcagtggggttgaaaagatcaagaccattggcagcacctac
atggcagcgacgggtctgagtgctgtgcccagccaggagtacgcccaggagcccgagcgg
cagtacatgcacataggcaccatggtggagtttgcctttgccctggtggcaaaactggac
gccatcaacaagcactccttcaatgacttcaagctgcgcgtgggtatcaatcatgggcct
gtaattgctggtgtaattggagctcagaagccacagtacgatatctggggcaacaccgtc
aatgtggccagcaggatggacagcaccggagtcctggacaaaatccaggttactgaggaa
acgagcctcatcctccagacacttgggtacacgtgcacctgccgaggcataatcaacgtg
aaaggcaagggggacctgaagacgtactttgtaaacacagaaatgtccaggtccctttcc
cagagcaacgtggcatcctga

KEGG   Tupaia chinensis (Chinese tree shrew): 102496578
Entry
102496578         CDS       T02978                                 

Gene name
ADCY7
Definition
(RefSeq) adenylate cyclase 7
  KO
K08047  adenylate cyclase 7 [EC:4.6.1.1]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00230  Purine metabolism
tup01100  Metabolic pathways
tup01522  Endocrine resistance
tup04015  Rap1 signaling pathway
tup04020  Calcium signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04024  cAMP signaling pathway
tup04062  Chemokine signaling pathway
tup04072  Phospholipase D signaling pathway
tup04114  Oocyte meiosis
tup04211  Longevity regulating pathway
tup04213  Longevity regulating pathway - multiple species
tup04261  Adrenergic signaling in cardiomyocytes
tup04270  Vascular smooth muscle contraction
tup04371  Apelin signaling pathway
tup04540  Gap junction
tup04611  Platelet activation
tup04713  Circadian entrainment
tup04714  Thermogenesis
tup04723  Retrograde endocannabinoid signaling
tup04724  Glutamatergic synapse
tup04725  Cholinergic synapse
tup04727  GABAergic synapse
tup04750  Inflammatory mediator regulation of TRP channels
tup04911  Insulin secretion
tup04912  GnRH signaling pathway
tup04913  Ovarian steroidogenesis
tup04914  Progesterone-mediated oocyte maturation
tup04915  Estrogen signaling pathway
tup04916  Melanogenesis
tup04918  Thyroid hormone synthesis
tup04921  Oxytocin signaling pathway
tup04923  Regulation of lipolysis in adipocytes
tup04925  Aldosterone synthesis and secretion
tup04926  Relaxin signaling pathway
tup04927  Cortisol synthesis and secretion
tup04928  Parathyroid hormone synthesis, secretion and action
tup04934  Cushing syndrome
tup04935  Growth hormone synthesis, secretion and action
tup04970  Salivary secretion
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup04976  Bile secretion
tup05032  Morphine addiction
tup05163  Human cytomegalovirus infection
tup05166  Human T-cell leukemia virus 1 infection
tup05200  Pathways in cancer
tup05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102496578 (ADCY7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102496578 (ADCY7)
   04371 Apelin signaling pathway
    102496578 (ADCY7)
   04020 Calcium signaling pathway
    102496578 (ADCY7)
   04072 Phospholipase D signaling pathway
    102496578 (ADCY7)
   04024 cAMP signaling pathway
    102496578 (ADCY7)
   04022 cGMP-PKG signaling pathway
    102496578 (ADCY7)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102496578 (ADCY7)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102496578 (ADCY7)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102496578 (ADCY7)
   04062 Chemokine signaling pathway
    102496578 (ADCY7)
  09152 Endocrine system
   04911 Insulin secretion
    102496578 (ADCY7)
   04923 Regulation of lipolysis in adipocytes
    102496578 (ADCY7)
   04912 GnRH signaling pathway
    102496578 (ADCY7)
   04913 Ovarian steroidogenesis
    102496578 (ADCY7)
   04915 Estrogen signaling pathway
    102496578 (ADCY7)
   04914 Progesterone-mediated oocyte maturation
    102496578 (ADCY7)
   04921 Oxytocin signaling pathway
    102496578 (ADCY7)
   04926 Relaxin signaling pathway
    102496578 (ADCY7)
   04935 Growth hormone synthesis, secretion and action
    102496578 (ADCY7)
   04918 Thyroid hormone synthesis
    102496578 (ADCY7)
   04928 Parathyroid hormone synthesis, secretion and action
    102496578 (ADCY7)
   04916 Melanogenesis
    102496578 (ADCY7)
   04925 Aldosterone synthesis and secretion
    102496578 (ADCY7)
   04927 Cortisol synthesis and secretion
    102496578 (ADCY7)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102496578 (ADCY7)
   04270 Vascular smooth muscle contraction
    102496578 (ADCY7)
  09154 Digestive system
   04970 Salivary secretion
    102496578 (ADCY7)
   04971 Gastric acid secretion
    102496578 (ADCY7)
   04972 Pancreatic secretion
    102496578 (ADCY7)
   04976 Bile secretion
    102496578 (ADCY7)
  09156 Nervous system
   04724 Glutamatergic synapse
    102496578 (ADCY7)
   04727 GABAergic synapse
    102496578 (ADCY7)
   04725 Cholinergic synapse
    102496578 (ADCY7)
   04723 Retrograde endocannabinoid signaling
    102496578 (ADCY7)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102496578 (ADCY7)
  09149 Aging
   04211 Longevity regulating pathway
    102496578 (ADCY7)
   04213 Longevity regulating pathway - multiple species
    102496578 (ADCY7)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102496578 (ADCY7)
   04714 Thermogenesis
    102496578 (ADCY7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102496578 (ADCY7)
  09165 Substance dependence
   05032 Morphine addiction
    102496578 (ADCY7)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102496578 (ADCY7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102496578 (ADCY7)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102496578 (ADCY7)
   05163 Human cytomegalovirus infection
    102496578 (ADCY7)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102496578 (ADCY7)
Enzymes [BR:tup01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102496578 (ADCY7)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N
Other DBs
NCBI-GeneID: 102496578
NCBI-ProteinID: XP_006154858
LinkDB
Position
Un
AA seq 1073 aa
MPAKGRYFLNEGEEGPDQDALYEKYRLTSQHGPLLLTLLLVAITACVTLIAIAFSQEEHP
NQAVLVTAFLTLVVFVALYVLVYAGCLVRRWLRASALLTWACLMALGCVLVFDSGGKEAC
ALEQVPYFLFVVFVVYTLLPFSMLGAIMAGTVSTIFHLLVLGVLMGAFTKPSISKGLQLL
ANVVIFLCGNLTGAFHKHQMQDASRDLFTYTVKCIQIRRKLRIEKRQQENLLLSVLPAHI
SMGMKLAIIERLKERGDRRYLPDNNFHSLYVKRHQNVSILYADIVGFTRLASDCSPKELV
VVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPTHARNCVKMGLDMCEAIKQV
REATGVDINMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPGRVHITEATL
NHLDKAYEVEDGHGQQRDPYLREMNIRTYLVIDPRSQQPPPPSQHLPKPKGDAALKMRAS
VRMTRYLESWGAARPFAHLNHRESVSSGETPVPNGRRPKAIPLRRHRAPDRSASPKGRSE
DDSYDDEMLSAIEGLSSTRPCCSKSDDFYTCGSIFLEKGFEREYRLAPIPQARHDFACAG
FIFICILLVHVLLVPRTTALGVSFGLAACALGLVLGLCFATEFLRCCPARGVLRAISERV
ETQPLLRLTLVVLTIGSLLTVTVVNLPVMPFPALALPGGNETRSGASSPCNLLPYYTCSC
ILGLMSCSVFLRMSLELKVVLLTVALVADLVLFHVYTCWQGDCCSHSLSNLTGTNGTLSA
SDCFWRDLKTMVSFYLALFYVTLLMLSRQIDYYCRLDCLWKKKFKKEHEEFETMENVNRL
LLENVLPAHVAAHFIGDKLNEDWYHQSYDCVCVMFASVPDFKVFYTECDVNKEGLECLRL
LNEIIADFDELLLKPKFSGVEKIKTIGSTYMAAAGLSVTSGHENQDLERQHAHIGVMVEF
SLALMGKLDGINRHSFNNFRLRVGINHGPVIAGVIGARKPQYDIWGNTVNVASRMESTGE
LGKIQVTEETCTILQGLGYSCECRGLINVKGKGELRTYFVCTDTAKFQGLGLN
NT seq 3222 nt   +upstreamnt  +downstreamnt
atgccagccaaggggcgctacttcctcaatgagggtgaggagggccccgaccaagatgcg
ctctacgagaagtaccgcctcaccagccagcatgggccgctgctgctcacactcctgttg
gtggctatcaccgcttgcgtcaccctcatcgccattgccttcagccaggaggagcacccc
aaccaggctgtcctggtcacggcgttcctgacactggtggtgtttgtggccctctacgtg
ctggtgtatgccgggtgcctcgtccggcggtggctcagggcctcggcgctgctcacctgg
gcctgcctcatggcactgggctgcgtgctggtgttcgactctggggggaaggaggcctgt
gcgttggagcaggtgccctacttcctgttcgtcgtcttcgtggtatacacgctgctgccc
ttcagcatgctgggagccatcatggcgggtaccgtctccaccatcttccacctcctggtg
ctcggcgtgctgatgggggccttcacgaagcccagcatctcgaaggggctgcagctgctg
gccaacgtggtcatcttcctgtgcgggaacctcaccggcgccttccacaagcaccagatg
caggacgcctcccgagacctcttcacctacaccgtgaagtgcatccagatccggaggaag
ctgcgcatcgagaagcgccagcaggagaacctgctgctctccgtgttgccggcccacatc
tccatgggcatgaagctggccatcattgagcggctcaaggagcgcggggatcggcgctac
ctgcccgacaacaacttccacagcctctacgtcaagcggcaccagaacgtcagtatcctg
tacgcagacattgtgggcttcacgcgtctggccagtgactgctcccccaaggagctggtg
gtggtcctgaatgagctcttcggcaagttcgaccagatcgccaaggccaacgagtgcatg
cggatcaagatcctgggcgactgctactactgcgtgtcgggcctgcctgtgtccctgccc
acccatgcccggaactgtgtgaagatgggactggacatgtgtgaggccatcaagcaggtg
cgggaggccacgggtgtggacatcaacatgcgtgtgggcatacactcggggaacgtactg
tgcggtgtcatcgggctgcgcaagtggcagtacgacgtgtggtcccacgacgtgtccctg
gccaaccggatggaggcggcaggagttcccggccgggtgcacatcacagaggcgacgctg
aaccacctggacaaggcgtacgaggtggaggacgggcacggccagcagcgagacccctac
ctgagggagatgaacatccgcacctacctggtcatcgacccccggagccagcagccgcca
ccacccagccagcacctccccaagcccaagggcgacgcggccctgaagatgcgggcgtcg
gtgcggatgacccgctacctcgagtcctggggggcggcccggcccttcgcacacctcaac
caccgcgagagcgtgagcagtggagagacccccgttcccaatgggcggaggcccaaggcc
attcctctgcggcgccaccgggcccctgacaggagtgcatcccccaaggggcggtcggag
gatgactcgtatgacgacgagatgctgtcggccattgaagggctcagctccaccaggccc
tgctgctccaagtccgatgacttctacacctgtgggtccatcttcctggagaagggcttt
gagcgtgagtaccgcctggcgcccatccctcaggcccgccacgacttcgcctgtgctggc
ttcatcttcatctgcatcctgctcgtccatgtcctcctggtacccaggacgacggctctg
ggagtgtccttcgggctggcggcctgcgcgctggggctggtgctcggcctgtgttttgcc
actgagttcctgcgatgctgccccgcacggggggtgctccgggccatctctgagagggtg
gagacgcagcccctgctgaggctgaccctggtggtgctgacgatcgggagcctgctcacc
gtcaccgtcgtcaacctgccagtgatgccattcccagccctggcactaccaggaggcaac
gagacgcgcagcggggcaagttccccgtgcaacctgctcccgtattacacctgcagctgc
atcctgggcctcatgtcctgctctgtcttcctgcggatgagcctggagctgaaggtcgtg
ctgttgacagtggccctggtggccgacctggtgctattccacgtctacacatgttggcag
ggcgactgctgcagccacagcctgagcaatctcaccgggaccaacggcaccctcagtgcc
tccgactgtttctggagggatctgaagaccatggtcagcttctacctggccctgttctat
gtcaccctgctcatgctctccagacagatcgactattactgccgcttggactgtctgtgg
aagaagaagttcaagaaggagcacgaggagttcgagaccatggagaacgtgaaccgcctg
ctcctggagaacgtcctgcccgcccatgtggccgcccacttcatcggggacaagctgaac
gaggactggtaccatcagtcctacgactgcgtctgcgtcatgttcgcatctgtgccggat
ttcaaagtgttctacacggagtgcgacgtcaacaaggaggggctggagtgcctgcgcctg
ctaaacgagatcatcgccgacttcgacgagctgctgttaaagcccaagttcagcggcgtg
gagaagatcaagaccatcggcagcacgtacatggcagctgcggggctcagcgtcacctca
gggcacgagaatcaggacctagagcggcagcacgcccacattggcgtcatggtggagttc
agcctggccctgatgggcaagttggatggcatcaaccggcactccttcaacaacttccgc
ctgcgtgtcggcataaaccacggacccgtgattgctggagtgatcggggcacgcaagcct
cagtacgacatctggggaaacacggtcaatgtcgccagccgcatggagagcactggggag
cttgggaagatccaggttaccgaagagacgtgcaccatcctccagggactcggctactcc
tgtgagtgccgcgggctgataaacgtcaaaggcaaaggcgaactgaggacttactttgtc
tgtacagacactgccaagtttcaagggctggggctgaactga

DBGET integrated database retrieval system