KEGG   Tupaia chinensis (Chinese tree shrew): 102468679
Entry
102468679         CDS       T02978                                 

Gene name
BST1
Definition
(RefSeq) bone marrow stromal cell antigen 1
  KO
K18152  ADP-ribosyl cyclase 2 [EC:3.2.2.6 2.4.99.20]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00760  Nicotinate and nicotinamide metabolism
tup01100  Metabolic pathways
tup04970  Salivary secretion
tup04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    102468679 (BST1)
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    102468679 (BST1)
   04972 Pancreatic secretion
    102468679 (BST1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:tup04090]
    102468679 (BST1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:tup00537]
    102468679 (BST1)
Enzymes [BR:tup01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.20  2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase
     102468679 (BST1)
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.6  ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase
     102468679 (BST1)
CD molecules [BR:tup04090]
 Proteins
  102468679 (BST1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:tup00537]
 Enzymes
  102468679 (BST1)
SSDB
Motif
Pfam: Rib_hydrolayse
Other DBs
NCBI-GeneID: 102468679
NCBI-ProteinID: XP_014441910
LinkDB
Position
Un
AA seq 227 aa
LLRREERNKNCTAIWEAFKVVLDKDPCSVFPSDYDLFINLSWHSLPRDKSLFWENNHLLV
TSYAENTRRLMPLCDVLYGRLGDFLSWCRQNNASELDYQSCPTSEDCENNPVDSFWKRAS
MQYSKDSSGVIYVMLNGSEQTGAYPIKGYFADYEIPYFQKDKITRIEIWVMHEIGGPSIE
SCGEGSVKILEERLEKMGFQYSCINDYLPVKLLKCVDHSTHPDCALK
NT seq 684 nt   +upstreamnt  +downstreamnt
ctgctgcgtcgggaggagcggaacaagaactgcacagccatctgggaagcctttaaggtg
gtgctggacaaggatccctgctcagttttcccctcggactatgacctttttatcaacctc
tcctggcactcacttcccagagacaagtccctgttctgggaaaataaccacctccttgtt
actagctatgcagagaacacccgtcgcttaatgcccctgtgtgatgttctgtatggcagg
cttggagattttttgagctggtgtcggcagaacaatgcctctgaacttgattaccaatcc
tgccctacatcagaagattgtgaaaataatcctgtggattccttctggaagagggcatcc
atgcagtattcaaaggatagctctggggtgatctacgtcatgctgaatggttcagagcaa
acaggagcctatcccattaaaggttattttgcagattatgaaatcccatacttccagaag
gataagatcacgcgaattgagatctgggtcatgcatgaaattggggggcccagcatagaa
tcatgtggagaaggcagcgtgaaaatcctggaggagagactggagaagatggggttccag
tacagctgcattaatgattacctaccagtgaagctcttaaagtgtgtggaccacagcact
catcctgactgtgccttgaaatag

KEGG   Tupaia chinensis (Chinese tree shrew): 102480083
Entry
102480083         CDS       T02978                                 

Gene name
CD38
Definition
(RefSeq) CD38 molecule
  KO
K01242  ADP-ribosyl cyclase 1 [EC:3.2.2.6 2.4.99.20]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00760  Nicotinate and nicotinamide metabolism
tup01100  Metabolic pathways
tup04020  Calcium signaling pathway
tup04640  Hematopoietic cell lineage
tup04921  Oxytocin signaling pathway
tup04970  Salivary secretion
tup04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    102480083 (CD38)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    102480083 (CD38)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102480083 (CD38)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102480083 (CD38)
  09154 Digestive system
   04970 Salivary secretion
    102480083 (CD38)
   04972 Pancreatic secretion
    102480083 (CD38)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:tup04090]
    102480083 (CD38)
   00536 Glycosaminoglycan binding proteins [BR:tup00536]
    102480083 (CD38)
Enzymes [BR:tup01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.20  2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase
     102480083 (CD38)
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.6  ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase
     102480083 (CD38)
CD molecules [BR:tup04090]
 Proteins
  102480083 (CD38)
Glycosaminoglycan binding proteins [BR:tup00536]
 Hyaluronan
  Cell surface receptors
   102480083 (CD38)
SSDB
Motif
Pfam: Rib_hydrolayse
Other DBs
NCBI-GeneID: 102480083
NCBI-ProteinID: XP_006144966
LinkDB
Position
Un
AA seq 305 aa
ALAVAKPGSEDKPLCRRARKAWIGAGLLVATAATVVVVVVVVVKGLPRPDPPEWSAQGST
PHLADIVLGRCFGYTQLLRPELRDKDCQKIWDAFKNAFISKSPCNITEDDYQPLLKLANQ
TLPCNKTLLWSKTNVLAHQYSRVQGDMLTLEDTLLGYLADGLMWCGDASSSEINYKSCPD
WRKDCSNNPQSVFWKTISQSFAEAACGMVHVMLNGSISKAFDKNSILGSVEILHLNPEKV
HTLQVWVMHSVGGISSDSCSGSSVNELKMIINKRNIAFVCQDDYRPAKFVQCVKNHEHSS
CRSVV
NT seq 918 nt   +upstreamnt  +downstreamnt
gccttggcggtggcgaagccggggtcggaggacaagcccctctgccggagagccaggaaa
gcctggataggcgcgggcctcctggtcgcgactgcagccacggtggtcgtcgtggtggtg
gtggtggtgaaggggctcccgcggccggatcccccggagtggagcgcgcagggcagcacc
ccgcacctcgccgacatcgtcctggggcgctgcttcggctacactcagctcctgcgcccc
gagctgcgagataaagactgccaaaagatatgggatgcatttaaaaatgcatttatttca
aagagtccttgcaacattacagaagacgactatcaaccactactgaagttggcaaatcaa
accttaccttgcaacaagaccctcctctggagcaaaacgaatgtgctggcccatcagtac
tcacgggtccagggggacatgctcaccctggaggacacgctgctgggctaccttgctgac
ggtctcatgtggtgtggagatgcaagcagctctgaaataaactacaagtcttgcccagac
tggagaaaagactgcagcaacaacccccagtcagtattctggaaaacaatttcccagagt
tttgcagaagctgcctgtggtatggtccatgtgatgctcaatggatccatcagtaaagcc
tttgacaaaaacagcattcttggaagtgtggaaatccttcatttgaatccagagaaggtt
catacactacaggtctgggtgatgcatagtgttggaggaatttccagtgattcatgctca
ggttcctcagtaaatgaactgaaaatgataataaacaaaaggaatattgcattcgtctgc
caggatgactacagacctgccaagtttgttcagtgtgtgaagaatcatgagcattcatct
tgcagatctgtcgtctga

DBGET integrated database retrieval system