KEGG   Tupaia chinensis (Chinese tree shrew): 102468722
Entry
102468722         CDS       T02978                                 

Gene name
CPA3
Definition
(RefSeq) carboxypeptidase A3
  KO
K08780  carboxypeptidase A3 [EC:3.4.17.1]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04614  Renin-angiotensin system
tup04972  Pancreatic secretion
tup04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    102468722 (CPA3)
  09154 Digestive system
   04972 Pancreatic secretion
    102468722 (CPA3)
   04974 Protein digestion and absorption
    102468722 (CPA3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tup01002]
    102468722 (CPA3)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.1  carboxypeptidase A
     102468722 (CPA3)
Peptidases and inhibitors [BR:tup01002]
 Metallo peptidases
  Family M14: carboxypeptidase A family
   102468722 (CPA3)
SSDB
Motif
Pfam: Peptidase_M14 Propep_M14 GATase1_like DUF1642
Other DBs
NCBI-GeneID: 102468722
NCBI-ProteinID: XP_006150969
UniProt: L9KND4
LinkDB
Position
Un
AA seq 417 aa
MRFILPMGLIATTLAIAPVRFDREKVFRVKIQDEKEANIIKDLAKTNEIDFWYPDAMHHV
AAQMTVDFRVSEKESQSIQSALDQNKMPYQILINDLQEEIEKQFDVKEDKPGRHSYRKYN
SWDKIVAWTEKMVNKNPKMVSRIQIGSTVEDNPLYVLQIGKGGESRKAIFMDCGIHAREW
VSPAFCQWFVYQAIKTYGRKKIMTKLLDRMNFYVLPVFNVDGYIWSWTQNRMWRKNRSKN
QNSKCIGTDLNRNFNVSWNSFHNTGNPCQDIYRGPAPESEKETKAVTDFIRSHLKTIKAY
ITFHSYSQMLLFPYGYTTDKPPNHGDLDKVAKIGTDVLATRYETRYIYGPIASTIYPTSG
SSLDWAYDLGIKHTFAFELRDKGKFGFLLPESRIKSTCRETMLAVKFIAKYILKHTS
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgaggttcatcctgcccatgggtttaattgcgaccacactcgccattgctcctgtccgc
ttcgacagggagaaggtgttccgcgtgaaaatccaggatgagaaagaagctaacatcata
aaggacttggccaaaaccaatgagattgacttctggtatccagatgccatgcaccatgta
gctgctcaaatgacggtggatttccgagttagtgagaaggaatcccaatccatccagtct
gccttggatcaaaataaaatgccctatcaaatcctgattaatgatctacaggaagagatt
gagaagcagtttgacgttaaggaagacaagccaggcaggcacagctacaggaaatacaat
agctgggacaagattgtggcttggactgaaaaaatggtgaataagaatcccaaaatggtc
tctcgtattcaaattgggtctacagttgaagataatccactctatgttctccagattggg
aaaggaggtgaaagtagaaaggctatttttatggactgcggaattcatgcacgagaatgg
gtctccccagcattctgccagtggtttgtctatcaggcaatcaaaacttatggaagaaaa
aaaattatgaccaaactcttggaccgaatgaatttttatgtacttcctgtgttcaacgtt
gatggatatatctggtcttggacacagaaccgcatgtggagaaaaaatcggtccaaaaac
caaaactccaaatgcattggcactgacctcaacaggaattttaatgtttcctggaactct
tttcataacacaggaaatccctgtcaggacatctacaggggccctgcaccagagtctgag
aaagaaacgaaagctgtcactgacttcattcgaagccacctgaaaaccatcaaggcatac
atcactttccattcctactcccagatgctattgtttccctatgggtatacaacagacaag
ccacccaaccatggggacctggacaaagttgccaagattggcactgatgttctagctact
cggtatgaaacccgctacatctacggcccaatagcatcaacaatttacccaacatcgggt
tcttccttagactgggcttacgacttgggcatcaaacacacatttgcctttgagctccga
gataaaggcaaatttggttttctccttccagaatcgaggataaagtcaacctgtagagag
accatgctagctgtcaagtttattgccaagtacatcctcaagcatacttcctaa

KEGG   Tupaia chinensis (Chinese tree shrew): 102489569
Entry
102489569         CDS       T02978                                 

Gene name
CPA2
Definition
(RefSeq) carboxypeptidase A2
  KO
K01298  carboxypeptidase A2 [EC:3.4.17.15]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04972  Pancreatic secretion
tup04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    102489569 (CPA2)
   04974 Protein digestion and absorption
    102489569 (CPA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tup01002]
    102489569 (CPA2)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.15  carboxypeptidase A2
     102489569 (CPA2)
Peptidases and inhibitors [BR:tup01002]
 Metallo peptidases
  Family M14: carboxypeptidase A family
   102489569 (CPA2)
SSDB
Motif
Pfam: Peptidase_M14 Propep_M14
Other DBs
NCBI-GeneID: 102489569
NCBI-ProteinID: XP_006158885
LinkDB
Position
Un
AA seq 477 aa
MRLILFFGALFGHIYCRETFVGDQVLEIVPTNEEQMKNLMQLEAEEHLKLDFWKLPTMPG
ETVHIRVPFVNVQAVKVFLEAQGIAYSIMIEDVQLLLDQENEEMLFNQRRERNGNFNFGA
YHTLEEISQEMENLVAEYPSLVSQVNIGSSFENRPMNVLKFSTGGDKPAIWLDAGIHARE
WVTQATALWTAGAHAVGHSHVSHSHCCTCFGQFSTGGDKPAIWLDAGIHAREWVTQATAL
WTANKIASDYGKDPSITSLLDTMDIPARDTMEIFLLPVTNPDGYVFSQTKNRMWRKTRSK
VSGSLCVGVDPNRNWDAGFGGPGASKQPCSDSYHGPSANSEVEVKSIVDFIKSHGKVKAF
ITIHSYSQLLMFPYGYTCSKPDNFDELNEVAQKAAKSVASLHGTQYKVGPICSVIYQASG
GSIDWAYDFGIKYSFAFELRDTGRYGFLLPANQILPTAEETWLGLKTIMEHVRDHPY
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgaggttgatcctgttttttggtgccctttttgggcatatctactgtcgagaaacattt
gtgggagaccaagttcttgagattgtaccaacaaatgaagaacagatgaaaaatctgatg
caattggaggctgaagaacatctcaagcttgacttttggaaattacccaccatgccaggg
gagacagttcatatccgagttccttttgtcaacgtccaagcagtcaaagtattcttggag
gcccagggaattgcttattctatcatgattgaagatgttcagcttctgttggatcaagag
aatgaagaaatgctatttaatcagagaagagagcggaatggtaactttaattttggggcc
taccataccttggaagagatttcccaagaaatggaaaacctcgtggctgagtaccccagc
ctagtaagccaagtgaatatcggctcttcttttgagaaccggcccatgaacgtgctcaag
ttcagcactggaggagacaagccggccatctggctagacgccgggatccatgctcgagag
tgggttacgcaagctactgcactgtggacagcaggggcccacgctgtgggccattcacat
gtgagtcattcacattgctgtacttgtttcgggcagttcagcactggaggagacaagccg
gccatctggctagacgccgggatccatgctcgagagtgggttacgcaagctactgcactg
tggacagcaaacaagattgcctctgattatggaaaggatccatccatcacctcccttctg
gacaccatggatattcctgctcgtgacaccatggagatattcctcctgccagtcacaaac
cctgatggatatgtgttctcgcaaacgaaaaatcgtatgtggcggaagacccggtccaag
gtatctggaagcctctgtgtgggtgttgatcctaacaggaactgggacgctggttttgga
ggacccggagccagtaagcaaccttgctctgattcataccatggacccagtgccaactct
gaagttgaagtgaaatccattgtggacttcatcaagagtcatggaaaagtcaaagccttc
attaccatccacagctattcccagctgctgatgttcccctatgggtacacgtgtagcaag
ccagataacttcgatgagctgaatgaagtggcccaaaaggctgccaagtcggtggcaagc
ctgcatggcacccagtacaaagtgggaccgatctgctcagtcatctaccaagccagtgga
ggaagcatcgactgggcctatgattttggtattaaatactcatttgcctttgagctaaga
gacacaggtcgctatggcttcctcctgccggccaatcagatcctgcccacagctgaggag
acctggcttggcctgaagacaatcatggagcatgtgcgagaccatccctactag

KEGG   Tupaia chinensis (Chinese tree shrew): 102492627
Entry
102492627         CDS       T02978                                 

Gene name
CPA1
Definition
(RefSeq) carboxypeptidase A1
  KO
K08779  carboxypeptidase A1 [EC:3.4.17.1]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04972  Pancreatic secretion
tup04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    102492627 (CPA1)
   04974 Protein digestion and absorption
    102492627 (CPA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tup01002]
    102492627 (CPA1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:tup03110]
    102492627 (CPA1)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.1  carboxypeptidase A
     102492627 (CPA1)
Peptidases and inhibitors [BR:tup01002]
 Metallo peptidases
  Family M14: carboxypeptidase A family
   102492627 (CPA1)
Chaperones and folding catalysts [BR:tup03110]
 Intramolecular chaperones
  Other peptidases
   102492627 (CPA1)
SSDB
Motif
Pfam: Peptidase_M14 Propep_M14 Phage_min_tail
Other DBs
NCBI-GeneID: 102492627
NCBI-ProteinID: XP_006158894
UniProt: L9JBV7
LinkDB
Position
Un
AA seq 419 aa
MRELLILSVLLGAVLGHEDFVGHQVLRISAADEAQVQKVKELEDLEHLQLDFWRGPTRPD
SPIDVRVPFSGLQATKIFLETHGIRYETMIEDVQSLLDQEQEQMFAFRSLFTSTESFNYA
TYHTLQEIYDFMDILVAENPQLVSKIKIGDTYESRPIYVLKFSTGGNNRPAIWIDTGIHS
REWVTQASGVWFAKKITQDYGHDEVLTSVLNTMDIFLEIVTNPDGFAYTQSTNRLWRKTR
SHGTGSICVGVDPNRNWDAGFGLTGASSNPCSETYHGSFANSEVEVKSIVDFVKNHGNIK
AFISIHSYSQLLLYPYGYKEEPASDQKELDQLAQSAVTALASLYGTKYKYGSIIKAIYQA
SGSSIDWAYNQGIKYSFTFELRDTGRYGFLLPASQIVPTAQETWLGLRVIMDYTHRNPY
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgcgggagctgctgatcttgagtgtgctgctgggggccgtccttggccatgaagacttt
gttgggcaccaggtgctccgaatctctgcagctgatgaagcccaggtacagaaggtgaag
gagctggaggacctggagcacctgcagctggacttctggaggggcccaaccaggcctgac
tcccccatcgacgtccgagtgcccttttctggactccaggctaccaaaatcttcctagag
acccatggcatcaggtacgagaccatgattgaggacgtgcagtcgctgctggatcaggag
caggagcagatgtttgccttccggtccctgttcacctccaccgagtcctttaactacgcc
acctaccacaccctgcaggagatctatgactttatggatatactggtcgctgagaacccc
cagcttgtcagcaagatcaagatcggtgatacctatgaaagtcgtcctatttatgtgctg
aagtttagtacaggagggaacaatcgtccggccatctggattgacacgggcatccattcc
cgggagtgggtcacccaagccagcggagtctggtttgccaagaagatcacacaagactat
ggccatgatgaagttttaacttctgttcttaacaccatggacatcttcctggagattgtc
accaaccctgatggttttgcttacacccagagcacgaaccgcctgtggcgcaagacccgg
tcccacggtacaggctctatctgtgttggggtggaccccaacaggaactgggacgccggc
tttgggttgactggagccagcagcaacccctgctcagagacttaccacggcagttttgcc
aattctgaagtggaagtcaaatccattgtggactttgtgaagaaccatgggaacatcaag
gccttcatctccatccacagctactcccagctcctcctctatccctacggctataaagaa
gaaccagcctccgaccagaaagagctggatcagctagcccagtctgctgtgacggccctg
gcctctctgtacgggaccaaatacaagtatggcagcatcatcaaagcaatttatcaagcc
agtggaagcagcatcgactgggcctacaaccagggcatcaagtactccttcacctttgag
ctccgcgacactgggcgctatggcttcctcttgccggcctcccagattgtccccacggcc
caggagacgtggctgggacttcgggtcatcatggactacacccacaggaacccttactga

DBGET integrated database retrieval system