Tupaia chinensis (Chinese tree shrew): 102468765 Help Entry 102468765         CDS       T02978                                  Name (RefSeq) glutathione S-transferase P   KO K23790   glutathione S-transferase P [EC:2.5.1.18] Organism tup  Tupaia chinensis (Chinese tree shrew) Pathway tup00480   Glutathione metabolism tup00980   Metabolism of xenobiotics by cytochrome P450 tup00982   Drug metabolism - cytochrome P450 tup00983   Drug metabolism - other enzymes tup01100   Metabolic pathways tup01524   Platinum drug resistance tup05200   Pathways in cancer tup05204   Chemical carcinogenesis - DNA adducts tup05215   Prostate cancer tup05225   Hepatocellular carcinoma tup05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:tup00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     102468765   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     102468765    00982 Drug metabolism - cytochrome P450     102468765    00983 Drug metabolism - other enzymes     102468765  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102468765    05204 Chemical carcinogenesis - DNA adducts     102468765   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102468765    05215 Prostate cancer     102468765   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102468765   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102468765  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:tup02000]     102468765 Enzymes [BR:tup01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      102468765 Transporters [BR:tup02000]  Other transporters   Pores ion channels [TC:1]    102468765 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C GST_C_3 GST_N GST_N_2 GST_C_2 GST_N_3 Motif Other DBs NCBI-GeneID:  102468765 NCBI-ProteinID:  XP_006171330 LinkDB All DBs Position Un AA seq 210 aa AA seqDB search MPPYTIVYFPVRGRCEAMRMLLADQGQSWKEEVVTKETWMQGQLKASCLYGQLPKFQDGD FTLYQSNAILRHLGRSLGLYGKDQREAALVDIANDGVEDLRCKYATLIYTNYEAGKDDYV KALPGHLKPFETLLSQNQGGQTFLVGNQISFADYNLLDLLLIHQVLAPNCLDAFPLLSAY VARLCARPKLKAFLASPEHVNLPINGNGKQ NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atgccgccctacaccattgtctactttccagttcgagggcgctgcgaggccatgcgcatg ctgctggctgaccagggccagagctggaaggaggaggtggtgaccaaggagacctggatg cagggtcagctcaaggcctcttgtttgtacgggcagctccccaagttccaggacggagac ttcaccctgtaccagtccaatgccatcctgcgtcacctgggccgctccctcgggctgtat gggaaggaccagcgggaggcagccctggtggacatagcgaacgacggcgtggaggacctc cgctgcaaatacgccaccctcatctacaccaactatgaggcgggcaaggatgattatgtg aaggcgctgccggggcacctgaagcctttcgagaccctgctgtcccagaaccagggaggt cagaccttcctcgtgggcaaccagatctccttcgcggactataacctgctggacttgctg ctgatccaccaggtcctggccccaaactgcctggatgcctttcctctgctctcggcctat gtggctcgcctctgcgcccgacccaagctcaaggccttcttggcctctcctgagcatgtg aacctccccatcaatggcaacgggaaacagtga

DBGET integrated database retrieval system