KEGG   Tupaia chinensis (Chinese tree shrew): 102468828Help
Entry
102468828         CDS       T02978                                 

Gene name
HSD17B4
Definition
(RefSeq) hydroxysteroid 17-beta dehydrogenase 4
  KO
K12405  (3R)-3-hydroxyacyl-CoA dehydrogenase / 3a,7a,12a-trihydroxy-5b-cholest-24-enoyl-CoA hydratase / enoyl-CoA hydratase 2 [EC:1.1.1.- 4.2.1.107 4.2.1.119]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00120  Primary bile acid biosynthesis
tup01040  Biosynthesis of unsaturated fatty acids
tup01100  Metabolic pathways
tup01212  Fatty acid metabolism
tup04146  Peroxisome
Module
tup_M00861  beta-Oxidation, peroxisome, VLCFA
tup_M00862  beta-Oxidation, peroxisome, tri/dihydroxycholestanoyl-CoA => choloyl/chenodeoxycholoyl-CoA
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    102468828 (HSD17B4)
   01040 Biosynthesis of unsaturated fatty acids
    102468828 (HSD17B4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102468828 (HSD17B4)
Enzymes [BR:tup01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     102468828 (HSD17B4)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.107  3alpha,7alpha,12alpha-trihydroxy-5beta-cholest-24-enoyl-CoA hydratase
     102468828 (HSD17B4)
    4.2.1.119  enoyl-CoA hydratase 2
     102468828 (HSD17B4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short MaoC_dehydratas adh_short_C2 SCP2 KR MaoC_dehydrat_N Alkyl_sulf_C AbrB-like
Motif
Other DBs
NCBI-GeneID: 102468828
NCBI-ProteinID: XP_006162409
LinkDB All DBs
Position
Un
AA seq 735 aa AA seqDB search
MALPLRFDGRVVLVTGAGGGLGRAYALAFAERGAFVVVNDLGGDFKGVGRGSVAADKVVE
EIRRRGGKAVANYDSVEAGEKIVKTALDAFGRIDIVVNNAGILRDRSFSRISDEDWDIIH
RVHLRGSFQVTRAAWDHMKKQNYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLSNTLAI
EGRKSNIHCNTIAPTAGSRMTQSVMPEDLVEALKPDYVAPLVLWLCHESCEENGGLFEVG
AGWIGKLRWERTLGAIVRKKNQPMTPEAVQAHWKEICNFDNAHKVQTVQESTASIVEVLS
KVDSEGGVSPNRTSHAASATSGFAGAVGHKLPSFSSEYTELEAIMYALGVGASAKDPKDL
KFIYEGSSDFSCLPTFGVIIAQKSIMGGGLAEIPGLSINYAKVLHGEQYLELHKPLPRTG
KLRCEAVVADILDKGSGAVILIDVHSYFGKELICYNQFSIFLVGSGGFGGKRTSGKIKEA
VAVPNRPPDAVLTDATSLNQAALYRLSGDWNPLHIDSNFANLAGFDKPILHGLCTFGFSA
RHVLQHFANNDVSRFKAIKARFAKPVYPGQTLQTEMWKEGNRIHFQTKVQGTGDIVIANA
YVDLVPTAAVPAKTPSEVGELQSTLVFEEIGRRLKDVGPEVVKKVNAVFEWHITRGGSLA
AKWTIDLKNGSGKVYQGPAKGSADTTIILSDGDFMDVVLGKLDPQKAFFSGRLKARGNIM
LSQKLQMILKDYAKL
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atggccttgccgctgcggttcgacgggcgggtggtgctggtcaccggcgcggggggagga
ttgggccgagcgtatgccctggcttttgcagaaagaggagcattcgttgttgtgaatgat
ttaggaggagattttaaaggcgttggaagaggctctgtagctgccgataaagttgtggaa
gaaataagaaggagaggaggcaaagctgtggccaactacgattcagtggaagcgggagag
aagatcgtgaagacagcactggacgcttttggaagaatagacattgtggtcaacaatgca
ggaattctgagggaccgttccttttctagaataagtgatgaagactgggatataatccat
cgagttcatttgcggggttcattccaagtgacccgggcggcctgggaccacatgaagaag
cagaattacggaaggatcattatgacttcgtcagcctcaggaatatacggcaacttcggc
caggcaaattacagtgctgcaaagctaggtcttctaggtctttccaataccctggcgatc
gaaggccgcaaaagtaacattcactgtaacaccatcgcccccactgccgggtcccggatg
actcagagtgttatgcctgaagatctggtggaagccctgaagcctgactacgtggcgccg
ctagtcctctggctctgccatgagagctgtgaggagaacggcggcttattcgaggttgga
gcaggatggattggaaaattgcgctgggagcggaccctgggcgccattgtgaggaagaag
aatcagccaatgactccggaggcggtccaggcgcactggaaggagatctgcaactttgac
aatgcccacaaggtgcagactgtccaagaatcaactgccagtatagtcgaagttctgagt
aaagtagattcagaaggaggagtttctccaaatcgtaccagtcacgcagcgtcggccaca
tcaggatttgctggagctgttggccataaactcccttcattttcctctgagtatacggag
ctggaagctattatgtacgcccttggagtgggggcatcagccaaggatcccaaggattta
aaattcatttacgaaggaagttctgatttctcctgtttgcctacctttggagttatcata
gcgcagaaatctataatgggcggaggattagcagagattcctgggctttcaatcaactat
gcaaaggttcttcatggggagcagtacttggagttacataaaccgctgcccagaacagga
aaattaagatgtgaagcggttgttgctgatatcctagataaaggatctggagcagtcatt
cttatagacgtacattcttattttgggaaggagcttatatgctataatcagttctctatc
ttcctggttggctctggaggttttgggggaaaacggacatcgggcaaaatcaaggaagct
gtagccgtacctaacagacctcccgacgccgtgctgacagatgccacctccctcaatcag
gccgctttgtaccgcctcagtggagactggaatcccttacacattgattccaacttcgct
aacctagcaggttttgacaagcccatattacatgggctatgcacgtttggattttcggcc
agacatgtcttacagcattttgccaataatgacgtgtccagattcaaggcgattaaggct
cgttttgcaaaaccagtatatccgggacagactctacaaactgagatgtggaaggaagga
aacagaattcatttccaaaccaaggtccagggcactggggacattgtcattgcaaacgcg
tacgtggacctcgtgccgacagcggctgtccccgcgaagacgccctctgaggtcggggag
cttcagagcaccctggtgttcgaggagataggtcgccgcctgaaggacgttgggcctgag
gtggtgaagaaggtcaatgccgtgttcgagtggcacatcaccagagggggcagcctcgcc
gccaagtggacgattgacttgaaaaacggttctggaaaggtgtatcaaggccctgcgaaa
ggttctgccgacacaaccatcatcctctcagatggagatttcatggatgtggtcctcggc
aagctggaccctcagaaggcgttcttcagtggcagactgaaggcccgagggaacatcatg
ctgagccagaagctccagatgatcctcaaagactacgccaagctctga

DBGET integrated database retrieval system