KEGG   Tupaia chinensis (Chinese tree shrew): 102468994
Entry
102468994         CDS       T02978                                 

Gene name
DVL1
Definition
(RefSeq) dishevelled segment polarity protein 1
  KO
K02353  segment polarity protein dishevelled
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04150  mTOR signaling pathway
tup04310  Wnt signaling pathway
tup04330  Notch signaling pathway
tup04390  Hippo signaling pathway
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04916  Melanogenesis
tup04934  Cushing syndrome
tup05010  Alzheimer disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05165  Human papillomavirus infection
tup05200  Pathways in cancer
tup05217  Basal cell carcinoma
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102468994 (DVL1)
   04330 Notch signaling pathway
    102468994 (DVL1)
   04390 Hippo signaling pathway
    102468994 (DVL1)
   04150 mTOR signaling pathway
    102468994 (DVL1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102468994 (DVL1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102468994 (DVL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102468994 (DVL1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102468994 (DVL1)
   05226 Gastric cancer
    102468994 (DVL1)
   05217 Basal cell carcinoma
    102468994 (DVL1)
   05224 Breast cancer
    102468994 (DVL1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102468994 (DVL1)
   05022 Pathways of neurodegeneration - multiple diseases
    102468994 (DVL1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102468994 (DVL1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102468994 (DVL1)
SSDB
Motif
Pfam: Dishevelled Dsh_C DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 102468994
NCBI-ProteinID: XP_006164163
LinkDB
Position
Un
AA seq 696 aa
MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVK
EEIFDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQGTDSHTDLPPPLERTGGIGDSRPPSF
HPNVASSRDGMDNETGTESMVSHRRERARRRNREEAARTNGHPRGDRRRDLGLPPDSAST
VLSSELESSSFIDSDEDDNTSRLSSSTEQSTSSRLIRKHKRRRRKQRLRQTDRASSFSSI
TDSTMSLNIITVTLNMERHHFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEPGDM
LLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTIPRADPVRPIDP
AAWLSHTAALTGALPRYGTSPCSSAVTRTSSSSLTSSVPGAPQLEEAPLTVKSDMGAVVR
VMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYTHVEGFKERREARKYASSMLKHGFL
RHTVNKITFSEQCYYVFGDLCSNLAALNLNSGSSGASDQDTLAPLPHPAAPWPLGQGYPY
QYPGPPPCFPPAYQDPGFSYGSGSTGSQQSEGSKSSGSTRSSRRTPGREKERRAAGAGGS
GSESDHTVPSGTGGSGWRERPASQLSRGSSPRSQASTAAPGLPTLHPLTKTYAVVGGPPG
GPPVRELAAVPPELTGSRQSFQKAMGNPCEFFVDIM
NT seq 2091 nt   +upstreamnt  +downstreamnt
atggcggagactaagatcatctaccacatggacgaggaggagacgccgtacctggtcaag
ctgccggtggcccccgagcgtgtcacgctggccgacttcaagaacgtgctcagcaaccgg
cccgtgcacgcctacaaattcttcttcaagtccatggaccaggacttcggagtggtgaag
gaagagatcttcgatgacaacgccaagctgccctgcttcaatggccgtgtggtttcttgg
ctggtcctggccgagggcgctcactctgatgcagggtcccagggcacggacagccacacg
gacctgcccccacctctcgagaggacgggtggcattggggactcccggcctccctccttc
cacccaaatgtggccagcagccgtgacgggatggacaatgagactggcacagagtccatg
gttagccaccggcgagagcgagcccgacgccggaaccgcgaagaggcggcccgaactaac
gggcatccaagaggggaccggcggcgggacctggggttgcctccggacagcgcatccact
gtgctgagtagcgagctggagtccagcagcttcatcgactcagatgaggatgacaacacc
agccgactaagcagctccactgagcagagcacctcatctcggctcatccggaaacacaag
cgccggcggcggaagcagcgcctgcggcaaacagaccgggcctcctccttcagcagcatc
accgactccaccatgtccttgaatatcatcactgtcacgctcaacatggagaggcaccac
ttcctgggcatcagcatcgtgggccagagcaacgaccggggtgacggtggcatctacatt
ggttccatcatgaaaggcggggctgtggccgctgatggccgcatcgagccaggcgacatg
ctgctgcaggtgaacgatgtcaactttgagaacatgagcaacgacgatgctgtgcgcgtg
ctacgggagatagtgtcccagacagggcccatcagcctcacagtcgccaagtgctgggac
ccaaccccccggagctacttcactatcccaagggctgacccagtgcgacccatcgaccca
gctgcctggctgtcccacacggcggcgctgacgggagccttgccccgctacggtacgagc
ccctgctccagtgccgtcacccgcaccagctcctcctcactaaccagctcagtgcccggc
gctccacaactggaagaggcaccgctgacggtgaagagtgacatgggtgctgttgtccgg
gtcatgcagttgccggactcgggactggagatccgtgaccgcatgtggctcaagattact
attgccaatgccgtcattggagcggacgtggtggactggctgtacacgcatgtggagggc
ttcaaggagcgacgggaggccaggaagtacgccagcagcatgttgaagcacggcttcctg
cggcacacggtcaacaagatcaccttctctgagcagtgctactatgtctttggggacctg
tgcagcaatctcgcagctctgaacctcaacagtggctccagtggagcctcagatcaagac
acactggctccattgccccacccagctgccccctggcccctgggtcaaggctacccctac
cagtacccagggcccccaccctgcttcccgcctgcctaccaggaccccggcttcagctat
ggcagtggcagcactgggagtcagcagagcgaagggagcaaaagcagcgggtccacccgg
agcagccgtcggaccccgggccgcgagaaagagcgccgagcagctggagctggaggcagt
ggcagtgaatcagaccacacagtgccaagcgggacaggtggcagtggctggcgggagcgc
ccggccagccagcttagccgtggcagcagcccacgcagccaggcctcaactgctgcccca
gggctccctaccctgcacccactaactaagacctatgcagtggtgggtggaccacccggg
ggaccacctgtccgggagctggctgctgtccccccagaattgacaggcagccgtcagtcc
ttccagaaggccatggggaacccctgtgagttctttgtggatatcatgtga

KEGG   Tupaia chinensis (Chinese tree shrew): 102472352
Entry
102472352         CDS       T02978                                 

Gene name
DVL3
Definition
(RefSeq) dishevelled segment polarity protein 3
  KO
K02353  segment polarity protein dishevelled
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04150  mTOR signaling pathway
tup04310  Wnt signaling pathway
tup04330  Notch signaling pathway
tup04390  Hippo signaling pathway
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04916  Melanogenesis
tup04934  Cushing syndrome
tup05010  Alzheimer disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05165  Human papillomavirus infection
tup05200  Pathways in cancer
tup05217  Basal cell carcinoma
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102472352 (DVL3)
   04330 Notch signaling pathway
    102472352 (DVL3)
   04390 Hippo signaling pathway
    102472352 (DVL3)
   04150 mTOR signaling pathway
    102472352 (DVL3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102472352 (DVL3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102472352 (DVL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102472352 (DVL3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102472352 (DVL3)
   05226 Gastric cancer
    102472352 (DVL3)
   05217 Basal cell carcinoma
    102472352 (DVL3)
   05224 Breast cancer
    102472352 (DVL3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102472352 (DVL3)
   05022 Pathways of neurodegeneration - multiple diseases
    102472352 (DVL3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102472352 (DVL3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102472352 (DVL3)
SSDB
Motif
Pfam: Dishevelled Dsh_C DIX PDZ DEP PDZ_6 Shufflon_N CDC45
Other DBs
NCBI-GeneID: 102472352
NCBI-ProteinID: XP_006160849
LinkDB
Position
Un
AA seq 616 aa
MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEI
SDDNAKLPCFNGRVVSWLVSAEGSHPEPAPFCADNPSELPPPLERTGGIGDSRPPSFHPH
AGGGSQENLDNDTETDSLVSAQRERPRRRDGPEHATRLNGAAKGERRREPGGYDSSSTLM
SSELETTSFFDSDEDDSTSRFSRSTEQSRASCLMRRNKRRRRKQKVSRMERSSSFSSITD
STMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLL
QVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRSEPIRPIDPAA
WVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTERLDDFHLSIHSDMAAIVKAMA
SPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHNVEGFTDRREARKYASNLLKAGFIRHT
VNKITFSEQCYYIFGDLCGNMANLSLHDHDGSSGASDQDTLAPLPHPGAAPWPMAFPYQY
PPPPHPYNPHPGFPELGYSYGGGPPVLMMPPPPAAMGPPGAPPGRDLASVPPELTASRQS
FRMAMGNPSEFFVDVM
NT seq 1851 nt   +upstreamnt  +downstreamnt
atgggcgagacgaagatcatctaccacctggacgggcaggagacgccgtacctggtgaag
ctgcccctgcccgccgagcgcgtcaccctggcggactttaagggcgtcctgcagcgcccc
agctataagttcttcttcaagtctatggacgacgacttcggagtggtgaaggaggagatc
tcagatgacaatgccaagctaccctgcttcaatggccgggtggtgtcctggctggtgtcg
gctgagggctcacacccagagccagcccccttctgtgctgacaacccatcggagctgccg
ccacctctggagcggacaggaggcatcggggactcccgacccccatccttccacccgcat
gctggtgggggcagccaggagaacctggacaatgacacagagacggactccttggtgtct
gcccagcgagagcggccacgccggagggacggcccagagcatgcaacccggctaaatgga
gctgcgaagggggagcggcggcgagaaccgggaggttacgatagctcgtccacccttatg
agcagcgagttggagaccaccagcttctttgactccgacgaggacgactccaccagcagg
ttcagccgctccacagagcagagcagagcctcttgcctcatgaggagaaacaagcggcgg
cggcggaagcagaaggtgtcccggatggagcggtcctcgtccttcagcagcatcacggac
tccaccatgtcactgaacatcatcaccgttactctcaacatggagaaatataacttcctg
ggcatctccatcgtgggccagagcaacgagcgtggcgacgggggcatctacatcggctcc
atcatgaagggcggggccgtggctgctgacgggcgcatcgagccgggagacatgctgtta
caggtgaacgagattaactttgagaacatgagtaacgacgatgcagtccgggtgctgcgt
gagattgtgcacaaaccagggcccatcaccctgactgtggccaagtgctgggaccccagt
ccacgtggttgcttcacactgcccaggagcgagcccatccggcccattgaccctgcggcc
tgggtctcccacactgcagccatgacgggcaccttccctgcctacggcatgagcccctcc
ctgagcaccatcacctccaccagctcctccatcaccagttccatccctgacacagagcgc
ctagatgacttccacctgtccatccacagtgacatggctgccatcgtgaaggccatggcc
tctcctgaatcagggctggaggtccgtgaccgcatgtggctcaagattaccatccccaac
gccttcatcggctcagatgtggtggactggctgtaccacaacgtggaaggcttcactgac
cggcgggaggcccgcaagtatgccagcaacctgctgaaagccggcttcatccgccacacc
gtcaacaagatcaccttctctgagcagtgctactacatcttcggggacctctgtggcaac
atggccaacctgtccctccacgaccacgatggctccagcggcgcctctgaccaggacacg
ctggcccctttgcctcacccgggggccgccccttggcccatggcgttcccttaccagtac
ccaccacccccgcacccctacaatccccaccctggcttcccggagctgggctacagctat
ggcgggggccccccggtgctgatgatgcccccgccgcccgcggccatggggcccccagga
gcccctccgggccgcgacctggcctccgtgccccccgaactgaccgccagcagacagtcc
ttccgcatggccatgggaaaccccagtgagttctttgtggatgtgatgtga

KEGG   Tupaia chinensis (Chinese tree shrew): 102485749
Entry
102485749         CDS       T02978                                 

Gene name
DVL2
Definition
(RefSeq) dishevelled segment polarity protein 2
  KO
K02353  segment polarity protein dishevelled
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04150  mTOR signaling pathway
tup04310  Wnt signaling pathway
tup04330  Notch signaling pathway
tup04390  Hippo signaling pathway
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04916  Melanogenesis
tup04934  Cushing syndrome
tup05010  Alzheimer disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05165  Human papillomavirus infection
tup05200  Pathways in cancer
tup05217  Basal cell carcinoma
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102485749 (DVL2)
   04330 Notch signaling pathway
    102485749 (DVL2)
   04390 Hippo signaling pathway
    102485749 (DVL2)
   04150 mTOR signaling pathway
    102485749 (DVL2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102485749 (DVL2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102485749 (DVL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102485749 (DVL2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102485749 (DVL2)
   05226 Gastric cancer
    102485749 (DVL2)
   05217 Basal cell carcinoma
    102485749 (DVL2)
   05224 Breast cancer
    102485749 (DVL2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102485749 (DVL2)
   05022 Pathways of neurodegeneration - multiple diseases
    102485749 (DVL2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102485749 (DVL2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102485749 (DVL2)
SSDB
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 102485749
NCBI-ProteinID: XP_006151963
LinkDB
Position
Un
AA seq 737 aa
MAGNSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSM
DQDFGVVKEEISDDNARLPCFNGRVVSWLVSSDNPQPETAPPAHEPRAELAPPPPPLPPL
PPERTSGIGDSRPPSFHPNVSSSHENLEPETETESVVSLRRERPRRRDSNEHGAGGHRPC
GPSRLERHLAGYESSSTLMTSELESTSLGDSDEDDTMSRCGPSXXXXXAPRLLKRHRRRR
KQRPPRLERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIM
KGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQ
AYFTLPRNEPIQPIDPAAWVSHSAALTGTFPAYPGSSSMSTITSGSSLPDGCEGRGLSIH
TDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYAS
GLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPLP
GATPWPLLPTFSYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGG
AGRPGRPEERAPESKSGSGSESEPSSRGGSVRRGGEPGGTGDGGPPPSRGSTGGAPNLRA
HPGLHPYGPPPGMALPYNPMMVVMMPPPPPPVPPAVQPPGAPPVRDLGSVPPELTASRQS
FHMAMGHPSEFLKKDVR
NT seq 2214 nt   +upstreamnt  +downstreamnt
atggcggggaacagcacggggggcggtggtgtcggggagacgaaggtgatttaccacctg
gatgaggaagagactccctacctggtgaagattcccgtccctgccgagcgcatcaccctc
ggcgatttcaagagcgttctgcagcggcccgcgggcgctaagtactttttcaagtctatg
gatcaggatttcggggtggtgaaggaggagatttcagatgacaatgcccgcctcccctgc
ttcaacggaagggtggtatcctggctagtgtcctcagataacccccaacctgagacggct
cccccagcccatgagcctcgggcagaactggcgcctccacccccaccattgcctcctttg
ccaccagagaggaccagcggcattggggactccaggcctccatccttccatcctaatgtg
tccagtagccatgaaaatctggagcctgagacagaaacggagtctgtagtgtcgctgagg
cgggagcggccccgcaggagagacagcaacgagcatggcgctgggggccatagaccctgt
ggcccctcgaggctggagcgccacctggctgggtacgagagctcctctacccttatgacc
agtgagctggagagcaccagcctgggggactcggatgaggacgataccatgagcaggtgt
ggcccctcnnnnnnnnnnnnnngggccccccgcctcctcaagcgccaccggcggcgaagg
aaacagcggccaccccgcctggagaggacctcatccttcagcagcgtcacggattctacc
atgtctctcaacatcatcacagtcacactcaacatggagaagtacaacttcctgggcatc
tccattgtgggccagagcaacgagcgcggagacggcggcatctacatcggctccatcatg
aagggaggggccgtggcggccgatgggcgcattgagccgggggacatgcttttgcaggtg
aatgacatgaactttgagaacatgagcaatgacgatgccgtgcgggtgctgagggacatt
gtgcacaagccgggccccatcgtgctgactgtggccaagtgttgggacccctctccccag
gcctatttcaccctcccccgcaatgagcccatccagccaattgaccctgctgcctgggtg
tcgcactccgccgcactgaccggcaccttcccagcatatccaggctcctcgtccatgagc
accatcacgtctgggtcctcgctgcccgatggctgtgagggccggggtctctccatccac
acggatatggcatctgtgaccaaggccatggcagctccagagtctgggctggaagtccgg
gaccgcatgtggctcaagatcaccatccctaatgcttttctgggttccgacgtggttgac
tggctctaccatcacgtggagggctttcctgagcggcgggaggcccgcaagtacgccagc
gggctgctcaaggcgggcctgatccggcacaccgtgaacaagatcaccttctctgagcag
tgctattatgtcttcggagacctcagtgggggctgtgagagctacctggtcaacctgtct
ctgaatgacaacgatggctccagcggggcttcggaccaggacaccttggctcctctgcct
ggggccactccctggccgctgctacccactttctcctaccagtacccagccccacacccc
tacagcccacagcctccgccctaccacgagctttcatcctacacctatggtgggggcagc
gcgagcagccagcacagtgaggggagccggagcagtgggtcgacacgcagtgatgggggc
gccgggcgcccagggaggcctgaggagcgggcccccgagtccaagtctggcagtggcagt
gagtcggagccctccagccgtgggggcagcgttcgacggggtggggagcctggcgggact
ggcgatggaggccctcccccgtccaggggctcaacggggggtgctccaaatctccgagcc
cacccagggctccatccgtacgggccaccccctggcatggccctcccctataacccaatg
atggtggtcatgatgcccccgcccccaccccctgtccctccagcggtacagcccccgggc
gcccctccagtcagagacctgggctctgtgcccccagaactgacggccagccgccaaagc
ttccacatggccatgggccaccccagtgagttcttaaaaaaagatgttaggtag

DBGET integrated database retrieval system