KEGG   Tupaia chinensis (Chinese tree shrew): 102469136
Entry
102469136         CDS       T02978                                 

Gene name
CPB1
Definition
(RefSeq) carboxypeptidase B1
  KO
K01291  carboxypeptidase B [EC:3.4.17.2]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04972  Pancreatic secretion
tup04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    102469136 (CPB1)
   04974 Protein digestion and absorption
    102469136 (CPB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tup01002]
    102469136 (CPB1)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.2  carboxypeptidase B
     102469136 (CPB1)
Peptidases and inhibitors [BR:tup01002]
 Metallo peptidases
  Family M14: carboxypeptidase A family
   102469136 (CPB1)
SSDB
Motif
Pfam: Peptidase_M14 Propep_M14 Intimin_C
Other DBs
NCBI-GeneID: 102469136
NCBI-ProteinID: XP_006150970
LinkDB
Position
Un
AA seq 417 aa
MLVFLVLLMVPLASAHHHGEHFEGEKVFRVSVGDENDVKLIHELASTNQIDFWKPDSVTQ
IKPHSSVDFRVKAEDTVTVEDFLDQNELQHEVLIHNLRNVLEAQFDSQVRATGHSYEKYN
KWETIEAWIEQVTADNPELISRQTIGTTFEGRTMHLLKVGKAGSDKPAIFMDCGFHAREW
ISPAFCQWFVREAVRTYGQEIHMTELLDKLDFYVLPVVNIDGYVYTWTKNRMWRKTRSTQ
SGTSCVGTDPNRNFDAGWCEIGASRSPCDETYCGSAAESEKETKALADFIRSNLSSIKAY
LTIHSYSQMMLYPYSYDYKLPANNVELNALAKATVKELASLHGTKYTYGPGATTIYPAAG
GSDDWAYDQGIKYSFTFELRDKGRYGFALPESQIRATCEETLLAIKHIASYVLEHLY
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgttggtgtttctggttctgttgatggtgcccttggcatctgctcatcatcatggtgag
cactttgaaggcgagaaggtgttccgtgtcagtgttggagatgagaatgacgtcaaatta
atccatgagttggccagcaccaaccaaatcgacttctggaaaccagattctgtcacccaa
atcaaacctcacagttcagttgacttccgtgttaaagcagaagatactgtcactgtcgag
gactttctggaccagaatgaactacaacatgaggtattgatacacaacctgagaaacgtg
ttggaggcccagtttgatagccaggtccgtgcgaccggacacagctatgagaagtacaac
aagtgggaaacgatagaggcttggattgaacaagtcactgctgataatccagagctcatc
tctcgtcaaaccatcggcaccacatttgaaggacggactatgcatctcctcaaggttggc
aaagctggatcagataagcctgctatcttcatggactgtggtttccatgccagagagtgg
atttctcctgcattttgtcagtggttcgtgagagaggctgttcgcacctatggacaggag
atccacatgacagagcttctcgacaagttagacttctatgtcctgcctgtggtcaacatt
gatggctatgtctacacctggaccaagaaccgaatgtggagaaagactcgctccacccag
tctggaacgtcctgtgttggcacagaccccaacagaaattttgacgctggttggtgtgaa
attggagcgtctcgaagcccctgtgatgaaacttactgcgggtctgcagccgagtctgaa
aaagagaccaaagccctggctgatttcatccgcagcaacctctcctccatcaaggcatac
ctgacgatccactcgtactcccagatgatgctctacccctactcctatgattacaaactc
cctgcgaacaacgttgagttgaatgccctggctaaagctactgtgaaagaactggcctca
ctgcacgggaccaagtacacatatggtccaggagccacaacgatctatcctgctgctgga
ggctctgacgactgggcttatgaccaagggatcaagtattccttcacctttgaactccgg
gataagggccggtatggctttgccctccccgagtcccagatccgggcgacctgtgaggag
acgctgttggccatcaagcacatcgccagctacgtcctggaacacctgtactag

DBGET integrated database retrieval system