KEGG   Tupaia chinensis (Chinese tree shrew): 102469136
Entry
102469136         CDS       T02978                                 

Gene name
CPB1
Definition
(RefSeq) carboxypeptidase B1
  KO
K01291  carboxypeptidase B [EC:3.4.17.2]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04972  Pancreatic secretion
tup04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    102469136 (CPB1)
   04974 Protein digestion and absorption
    102469136 (CPB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tup01002]
    102469136 (CPB1)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.2  carboxypeptidase B
     102469136 (CPB1)
Peptidases and inhibitors [BR:tup01002]
 Metallo peptidases
  Family M14: carboxypeptidase A family
   102469136 (CPB1)
SSDB
Motif
Pfam: Peptidase_M14 Propep_M14 Intimin_C
Other DBs
NCBI-GeneID: 102469136
NCBI-ProteinID: XP_006150970
LinkDB
Position
Un
AA seq 417 aa
MLVFLVLLMVPLASAHHHGEHFEGEKVFRVSVGDENDVKLIHELASTNQIDFWKPDSVTQ
IKPHSSVDFRVKAEDTVTVEDFLDQNELQHEVLIHNLRNVLEAQFDSQVRATGHSYEKYN
KWETIEAWIEQVTADNPELISRQTIGTTFEGRTMHLLKVGKAGSDKPAIFMDCGFHAREW
ISPAFCQWFVREAVRTYGQEIHMTELLDKLDFYVLPVVNIDGYVYTWTKNRMWRKTRSTQ
SGTSCVGTDPNRNFDAGWCEIGASRSPCDETYCGSAAESEKETKALADFIRSNLSSIKAY
LTIHSYSQMMLYPYSYDYKLPANNVELNALAKATVKELASLHGTKYTYGPGATTIYPAAG
GSDDWAYDQGIKYSFTFELRDKGRYGFALPESQIRATCEETLLAIKHIASYVLEHLY
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgttggtgtttctggttctgttgatggtgcccttggcatctgctcatcatcatggtgag
cactttgaaggcgagaaggtgttccgtgtcagtgttggagatgagaatgacgtcaaatta
atccatgagttggccagcaccaaccaaatcgacttctggaaaccagattctgtcacccaa
atcaaacctcacagttcagttgacttccgtgttaaagcagaagatactgtcactgtcgag
gactttctggaccagaatgaactacaacatgaggtattgatacacaacctgagaaacgtg
ttggaggcccagtttgatagccaggtccgtgcgaccggacacagctatgagaagtacaac
aagtgggaaacgatagaggcttggattgaacaagtcactgctgataatccagagctcatc
tctcgtcaaaccatcggcaccacatttgaaggacggactatgcatctcctcaaggttggc
aaagctggatcagataagcctgctatcttcatggactgtggtttccatgccagagagtgg
atttctcctgcattttgtcagtggttcgtgagagaggctgttcgcacctatggacaggag
atccacatgacagagcttctcgacaagttagacttctatgtcctgcctgtggtcaacatt
gatggctatgtctacacctggaccaagaaccgaatgtggagaaagactcgctccacccag
tctggaacgtcctgtgttggcacagaccccaacagaaattttgacgctggttggtgtgaa
attggagcgtctcgaagcccctgtgatgaaacttactgcgggtctgcagccgagtctgaa
aaagagaccaaagccctggctgatttcatccgcagcaacctctcctccatcaaggcatac
ctgacgatccactcgtactcccagatgatgctctacccctactcctatgattacaaactc
cctgcgaacaacgttgagttgaatgccctggctaaagctactgtgaaagaactggcctca
ctgcacgggaccaagtacacatatggtccaggagccacaacgatctatcctgctgctgga
ggctctgacgactgggcttatgaccaagggatcaagtattccttcacctttgaactccgg
gataagggccggtatggctttgccctccccgagtcccagatccgggcgacctgtgaggag
acgctgttggccatcaagcacatcgccagctacgtcctggaacacctgtactag

KEGG   Tupaia chinensis (Chinese tree shrew): 102473098
Entry
102473098         CDS       T02978                                 

Gene name
CPB2
Definition
(RefSeq) carboxypeptidase B2
  KO
K01300  carboxypeptidase B2 [EC:3.4.17.20]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04610  Complement and coagulation cascades
tup04972  Pancreatic secretion
tup04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    102473098 (CPB2)
  09154 Digestive system
   04972 Pancreatic secretion
    102473098 (CPB2)
   04974 Protein digestion and absorption
    102473098 (CPB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tup01002]
    102473098 (CPB2)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.20  carboxypeptidase U
     102473098 (CPB2)
Peptidases and inhibitors [BR:tup01002]
 Metallo peptidases
  Family M14: carboxypeptidase A family
   102473098 (CPB2)
SSDB
Motif
Pfam: Peptidase_M14 Propep_M14
Other DBs
NCBI-GeneID: 102473098
NCBI-ProteinID: XP_006163508
LinkDB
Position
Un
AA seq 423 aa
MKLYNLAVLAAILLFCEQHVFGFQSGQVLSALPRTSRQVQILQNLTTTYEIVLWKPVTAE
FIAKKNEVHFFVNASDVNNVKANLNESSIPFSVLMRDVRDLIRQQTSNDTVSPRASSSYY
EQYHSLSEIYSWIEVITERYPDMLKKIHIGSSYEKHPLYVLKVSGKEQTAKPAMWIDCGV
HAREWISPAFCLWFIGYVTQYYGKEKLYTNLLRHMDFYVMPVVNVDGYDYTWKKNRMWRK
NRSSHGNNRCIGTDLNRNFASKHWCEEGASSSSCSEIYCGLYPESEPETKAMADFLRRNI
NHIKAYISMHSYAQHIVFPYSYNKNKSKDHEELSLLASEAVHAIERVNKNIKYTHGSGSE
SLYLAPGGSDDWIYDLGIKYSFTIELRDKGRYGFLLPERFIKPTCNEALAAVSKIAWHVI
RNA
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgaagctttataacctcgcagtcctcgcagccatcctcctcttctgtgagcagcatgtc
ttcgggtttcagagtggccaggttttatctgctctacctagaacctctaggcaagttcaa
attctgcagaatcttactacaacgtatgagattgttctttggaagccagtaactgctgaa
tttattgcaaagaaaaatgaagtccatttttttgtgaacgcatctgacgtaaacaacgtg
aaagccaatttaaatgagagcagcatcccattcagtgtcttgatgagagatgtgagagac
cttattcgacagcagacttccaatgacacggtcagccccagagcctcttcatcatattat
gaacagtatcattcactaagtgagatctattcttggatagaagtaataactgagcgatat
cctgatatgcttaaaaaaatccatattggctcctcctatgagaagcacccactgtatgtt
ttaaaggtttcaggaaaagaacaaacggccaaaccggccatgtggattgattgtggggtc
catgccagagaatggatctctcctgcattctgcttgtggttcattggctacgtaactcaa
tactatgggaaagaaaaactatataccaatcttctgaggcacatggatttctatgttatg
ccagtggttaatgtggatggttatgactacacatggaaaaagaatcgaatgtggagaaag
aaccgttcctctcatgggaataaccgttgcattggaacagacctgaatagaaactttgct
tccaaacactggtgtgaggaaggtgcatcaagttcctcatgctcagaaatctactgtgga
ctttatcctgagtcggaaccagaaacaaaggcaatggctgatttcttgagaagaaatatc
aaccacattaaagcttatatcagcatgcattcgtatgcccaacatatagtgtttccatac
tcgtataataaaaacaaaagcaaagaccacgaggaactgtctctactggccagtgaagca
gttcatgctattgagagggttaataaaaatatcaagtatacacatggcagtggctcagaa
agtttatacctagctcctggaggttcagatgactggatttatgatttgggcatcaaatac
tcattcacgattgaacttcgtgataaaggcagatacggattcttgttgccagagcgtttc
atcaaacccacttgtaatgaagctcttgctgctgtctctaaaatagcttggcatgtcatc
agaaatgcctaa

DBGET integrated database retrieval system