KEGG   Tupaia chinensis (Chinese tree shrew): 102469271
Entry
102469271         CDS       T02978                                 

Gene name
PRKCB
Definition
(RefSeq) protein kinase C beta
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01521  EGFR tyrosine kinase inhibitor resistance
tup04010  MAPK signaling pathway
tup04012  ErbB signaling pathway
tup04014  Ras signaling pathway
tup04015  Rap1 signaling pathway
tup04020  Calcium signaling pathway
tup04062  Chemokine signaling pathway
tup04064  NF-kappa B signaling pathway
tup04066  HIF-1 signaling pathway
tup04070  Phosphatidylinositol signaling system
tup04071  Sphingolipid signaling pathway
tup04150  mTOR signaling pathway
tup04270  Vascular smooth muscle contraction
tup04310  Wnt signaling pathway
tup04370  VEGF signaling pathway
tup04510  Focal adhesion
tup04540  Gap junction
tup04650  Natural killer cell mediated cytotoxicity
tup04662  B cell receptor signaling pathway
tup04666  Fc gamma R-mediated phagocytosis
tup04670  Leukocyte transendothelial migration
tup04713  Circadian entrainment
tup04720  Long-term potentiation
tup04723  Retrograde endocannabinoid signaling
tup04724  Glutamatergic synapse
tup04725  Cholinergic synapse
tup04726  Serotonergic synapse
tup04727  GABAergic synapse
tup04728  Dopaminergic synapse
tup04730  Long-term depression
tup04750  Inflammatory mediator regulation of TRP channels
tup04911  Insulin secretion
tup04912  GnRH signaling pathway
tup04916  Melanogenesis
tup04918  Thyroid hormone synthesis
tup04919  Thyroid hormone signaling pathway
tup04921  Oxytocin signaling pathway
tup04925  Aldosterone synthesis and secretion
tup04928  Parathyroid hormone synthesis, secretion and action
tup04929  GnRH secretion
tup04931  Insulin resistance
tup04933  AGE-RAGE signaling pathway in diabetic complications
tup04935  Growth hormone synthesis, secretion and action
tup04960  Aldosterone-regulated sodium reabsorption
tup04961  Endocrine and other factor-regulated calcium reabsorption
tup04970  Salivary secretion
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup04973  Carbohydrate digestion and absorption
tup05017  Spinocerebellar ataxia
tup05022  Pathways of neurodegeneration - multiple diseases
tup05031  Amphetamine addiction
tup05032  Morphine addiction
tup05140  Leishmaniasis
tup05143  African trypanosomiasis
tup05146  Amoebiasis
tup05161  Hepatitis B
tup05163  Human cytomegalovirus infection
tup05164  Influenza A
tup05170  Human immunodeficiency virus 1 infection
tup05200  Pathways in cancer
tup05205  Proteoglycans in cancer
tup05206  MicroRNAs in cancer
tup05214  Glioma
tup05223  Non-small cell lung cancer
tup05225  Hepatocellular carcinoma
tup05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102469271 (PRKCB)
   04012 ErbB signaling pathway
    102469271 (PRKCB)
   04014 Ras signaling pathway
    102469271 (PRKCB)
   04015 Rap1 signaling pathway
    102469271 (PRKCB)
   04310 Wnt signaling pathway
    102469271 (PRKCB)
   04370 VEGF signaling pathway
    102469271 (PRKCB)
   04064 NF-kappa B signaling pathway
    102469271 (PRKCB)
   04066 HIF-1 signaling pathway
    102469271 (PRKCB)
   04020 Calcium signaling pathway
    102469271 (PRKCB)
   04070 Phosphatidylinositol signaling system
    102469271 (PRKCB)
   04071 Sphingolipid signaling pathway
    102469271 (PRKCB)
   04150 mTOR signaling pathway
    102469271 (PRKCB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102469271 (PRKCB)
   04540 Gap junction
    102469271 (PRKCB)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102469271 (PRKCB)
   04662 B cell receptor signaling pathway
    102469271 (PRKCB)
   04666 Fc gamma R-mediated phagocytosis
    102469271 (PRKCB)
   04670 Leukocyte transendothelial migration
    102469271 (PRKCB)
   04062 Chemokine signaling pathway
    102469271 (PRKCB)
  09152 Endocrine system
   04911 Insulin secretion
    102469271 (PRKCB)
   04929 GnRH secretion
    102469271 (PRKCB)
   04912 GnRH signaling pathway
    102469271 (PRKCB)
   04921 Oxytocin signaling pathway
    102469271 (PRKCB)
   04935 Growth hormone synthesis, secretion and action
    102469271 (PRKCB)
   04918 Thyroid hormone synthesis
    102469271 (PRKCB)
   04919 Thyroid hormone signaling pathway
    102469271 (PRKCB)
   04928 Parathyroid hormone synthesis, secretion and action
    102469271 (PRKCB)
   04916 Melanogenesis
    102469271 (PRKCB)
   04925 Aldosterone synthesis and secretion
    102469271 (PRKCB)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102469271 (PRKCB)
  09154 Digestive system
   04970 Salivary secretion
    102469271 (PRKCB)
   04971 Gastric acid secretion
    102469271 (PRKCB)
   04972 Pancreatic secretion
    102469271 (PRKCB)
   04973 Carbohydrate digestion and absorption
    102469271 (PRKCB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102469271 (PRKCB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102469271 (PRKCB)
  09156 Nervous system
   04724 Glutamatergic synapse
    102469271 (PRKCB)
   04727 GABAergic synapse
    102469271 (PRKCB)
   04725 Cholinergic synapse
    102469271 (PRKCB)
   04728 Dopaminergic synapse
    102469271 (PRKCB)
   04726 Serotonergic synapse
    102469271 (PRKCB)
   04720 Long-term potentiation
    102469271 (PRKCB)
   04730 Long-term depression
    102469271 (PRKCB)
   04723 Retrograde endocannabinoid signaling
    102469271 (PRKCB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102469271 (PRKCB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102469271 (PRKCB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102469271 (PRKCB)
   05206 MicroRNAs in cancer
    102469271 (PRKCB)
   05205 Proteoglycans in cancer
    102469271 (PRKCB)
   05231 Choline metabolism in cancer
    102469271 (PRKCB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102469271 (PRKCB)
   05214 Glioma
    102469271 (PRKCB)
   05223 Non-small cell lung cancer
    102469271 (PRKCB)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    102469271 (PRKCB)
   05022 Pathways of neurodegeneration - multiple diseases
    102469271 (PRKCB)
  09165 Substance dependence
   05031 Amphetamine addiction
    102469271 (PRKCB)
   05032 Morphine addiction
    102469271 (PRKCB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102469271 (PRKCB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102469271 (PRKCB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102469271 (PRKCB)
   05164 Influenza A
    102469271 (PRKCB)
   05161 Hepatitis B
    102469271 (PRKCB)
   05163 Human cytomegalovirus infection
    102469271 (PRKCB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102469271 (PRKCB)
   05140 Leishmaniasis
    102469271 (PRKCB)
   05143 African trypanosomiasis
    102469271 (PRKCB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102469271 (PRKCB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tup01001]
    102469271 (PRKCB)
Enzymes [BR:tup01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     102469271 (PRKCB)
Protein kinases [BR:tup01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   102469271 (PRKCB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like APH
Other DBs
NCBI-GeneID: 102469271
NCBI-ProteinID: XP_006148376
LinkDB
Position
Un
AA seq 834 aa
MADPAAGPPPNEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDREVLIVVGRTW
RKGSLCQVGTEPSPGSQCSAPWSHFQPPALGEIPACRVTHPVRVEHSLSQPEQTNTVSPR
GRLLRTESFAASLPPELSSFSPSGRLTVIPLTRPSPTEDAHDILNVNLRQRPVKPLRPTI
PGAASWHPHVLVRVVIIIQTERQALIDLILLDLALRSQGHLESCPGQPNSNQKLRKKVLA
QYFTVTNEHHRYGEELLVTLNVKISKNPHFQLKESDKDRRLSVEIWDWDLTSRNDFMGSL
SFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGSEGNEELRQKFERAKIGQGTKAPEE
KTTNTISKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVI
QDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFK
EPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTK
TFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVA
YPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKP
KACGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFSFVNSEFLKPEVKS
NT seq 2505 nt   +upstreamnt  +downstreamnt
atggctgacccggctgcggggccgccgccgaacgagggcgaggagagcacggtgcgcttc
gcccgcaaaggcgccctccggcagaagaacgtgcacgaggtgaagaaccacaaattcacc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggcttc
gggaagcagggattccagtgtcaagtttgctgctttgttgtgcacaagcggtgccatgag
tttgtcacgttctcctgccctggcgctgacaagggcccagcctctgatgatccccggagc
aaacacaagtttaagatccacacatactccagccccacgttttgtgaccactgtgggtcg
ctgctgtacggactcatccaccaggggatgaaatgtgacacgtgcatgatgaacgtccac
aagcgctgcgtgatgaacgtccccagcctctgtggcacagaccacacggagcgccgcggc
cgcatctacatccaggcccacatcgacagggaggtcctcatcgttgtcggaaggacgtgg
aggaaaggcagcctttgtcaggtgggaacagagccctcaccaggaagccagtgttcagct
ccctggtctcactttcagcctccagcactgggagaaatacctgcctgtcgtgtaacccac
cccgtccgtgttgaacattcgctatcgcagcctgagcagactaacaccgtcagtccccga
ggccggctgctgaggacagagtcattcgctgcttctcttcctccagagctcagctcattc
tcaccatcagggagactgacagtgatcccccttacacgtccttcccccactgaagatgct
catgacatcctgaatgtgaacttgcgtcagcggccagttaaacctctcaggcccaccatt
ccaggtgctgctagctggcatcctcacgtcctcgtgcgagttgttattatcattcagact
gaacgtcaggccctgatagacctcatcctgttggatttggcccttcgctctcagggccat
ctggagagctgccctgggcaacctaatagcaaccaaaagctaaggaaaaaggttttagct
cagtatttcacagtgacgaatgaacatcacagatatggagaggaacttctggtcaccttg
aacgtgaaaatcagcaagaatccccactttcagctgaaagaatcggataaagatagaaga
ctgtcagtagagatttgggactgggatctgaccagcagaaatgacttcatgggatctttg
tcatttgggatttctgaactgcagaaagctggtgttgatggctggtttaaattactgagc
caggaggaaggcgagtacttcaatgtgcctgtgccgccagaaggaagtgagggcaatgaa
gaattgcggcagaaatttgagagggccaagatcggtcagggaaccaaggctccggaagaa
aagacgaccaataccatatccaaatttgacaacaatggcaacagggatcggatgaaacta
actgattttaacttcctgatggtgctgggcaaaggcagctttggcaaggtcatgctctca
gagcgaaaaggcacagatgagctctatgctgtgaagatcctgaagaaggatgttgtgatc
caggatgatgacgtggagtgcaccatggtggagaagcgagtgctggccctgccagggaaa
ccgccattcctgacccagctccattcctgcttccagaccatggaccgcctgtactttgtt
atggagtatgtgaatggaggtgacctcatgtaccacatccagcaagttggccgtttcaaa
gagcctcatgctgtattttatgctgcagaaattgccatcggcctgttcttcttacagagc
aagggcatcatttaccgtgacctaaaacttgacaacgtgatgctggattctgaggggcac
atcaagattgctgattttggcatgtgtaaggaaaacatctgggatggggtgacaaccaag
acattctgtggcactccagactacattgcacctgagataattgcttatcagccctatggg
aagtctgtggattggtgggcattcggagttctgctgtatgaaatgttggctgggcaggca
ccctttgaaggggaggatgaggatgaactcttccagtccattatggaacacaatgtggct
tatccaaagtccatgtccaaggaagctgtggccatttgcaaagggctgatgaccaaacac
ccaggcaaacgattgggttgcggacctgaaggtgaacgtgacatcaaagagcacgcattt
ttccggtatatcgactgggagaaacttgaacgcaaagagattcagcctccgtataagcca
aaagcttgtgggcgaaatgctgaaaacttcgaccggtttttcacccgccatccaccagtc
ctaacacctcctgaccaggaagtcatcaggaatattgaccaatcagaattcgaaggattt
tcctttgttaactctgaatttttaaaacctgaagtcaagagctaa

KEGG   Tupaia chinensis (Chinese tree shrew): 102495954
Entry
102495954         CDS       T02978                                 

Gene name
PRKCA
Definition
(RefSeq) protein kinase C alpha
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01521  EGFR tyrosine kinase inhibitor resistance
tup04010  MAPK signaling pathway
tup04012  ErbB signaling pathway
tup04014  Ras signaling pathway
tup04015  Rap1 signaling pathway
tup04020  Calcium signaling pathway
tup04066  HIF-1 signaling pathway
tup04070  Phosphatidylinositol signaling system
tup04071  Sphingolipid signaling pathway
tup04072  Phospholipase D signaling pathway
tup04150  mTOR signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04261  Adrenergic signaling in cardiomyocytes
tup04270  Vascular smooth muscle contraction
tup04310  Wnt signaling pathway
tup04360  Axon guidance
tup04370  VEGF signaling pathway
tup04510  Focal adhesion
tup04540  Gap junction
tup04650  Natural killer cell mediated cytotoxicity
tup04664  Fc epsilon RI signaling pathway
tup04666  Fc gamma R-mediated phagocytosis
tup04670  Leukocyte transendothelial migration
tup04713  Circadian entrainment
tup04720  Long-term potentiation
tup04723  Retrograde endocannabinoid signaling
tup04724  Glutamatergic synapse
tup04725  Cholinergic synapse
tup04726  Serotonergic synapse
tup04727  GABAergic synapse
tup04728  Dopaminergic synapse
tup04730  Long-term depression
tup04750  Inflammatory mediator regulation of TRP channels
tup04911  Insulin secretion
tup04912  GnRH signaling pathway
tup04916  Melanogenesis
tup04918  Thyroid hormone synthesis
tup04919  Thyroid hormone signaling pathway
tup04921  Oxytocin signaling pathway
tup04925  Aldosterone synthesis and secretion
tup04926  Relaxin signaling pathway
tup04928  Parathyroid hormone synthesis, secretion and action
tup04929  GnRH secretion
tup04933  AGE-RAGE signaling pathway in diabetic complications
tup04935  Growth hormone synthesis, secretion and action
tup04960  Aldosterone-regulated sodium reabsorption
tup04961  Endocrine and other factor-regulated calcium reabsorption
tup04970  Salivary secretion
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup05017  Spinocerebellar ataxia
tup05022  Pathways of neurodegeneration - multiple diseases
tup05031  Amphetamine addiction
tup05032  Morphine addiction
tup05143  African trypanosomiasis
tup05146  Amoebiasis
tup05161  Hepatitis B
tup05163  Human cytomegalovirus infection
tup05164  Influenza A
tup05170  Human immunodeficiency virus 1 infection
tup05200  Pathways in cancer
tup05205  Proteoglycans in cancer
tup05206  MicroRNAs in cancer
tup05214  Glioma
tup05223  Non-small cell lung cancer
tup05225  Hepatocellular carcinoma
tup05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102495954 (PRKCA)
   04012 ErbB signaling pathway
    102495954 (PRKCA)
   04014 Ras signaling pathway
    102495954 (PRKCA)
   04015 Rap1 signaling pathway
    102495954 (PRKCA)
   04310 Wnt signaling pathway
    102495954 (PRKCA)
   04370 VEGF signaling pathway
    102495954 (PRKCA)
   04066 HIF-1 signaling pathway
    102495954 (PRKCA)
   04020 Calcium signaling pathway
    102495954 (PRKCA)
   04070 Phosphatidylinositol signaling system
    102495954 (PRKCA)
   04072 Phospholipase D signaling pathway
    102495954 (PRKCA)
   04071 Sphingolipid signaling pathway
    102495954 (PRKCA)
   04151 PI3K-Akt signaling pathway
    102495954 (PRKCA)
   04150 mTOR signaling pathway
    102495954 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102495954 (PRKCA)
   04540 Gap junction
    102495954 (PRKCA)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102495954 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    102495954 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    102495954 (PRKCA)
   04670 Leukocyte transendothelial migration
    102495954 (PRKCA)
  09152 Endocrine system
   04911 Insulin secretion
    102495954 (PRKCA)
   04929 GnRH secretion
    102495954 (PRKCA)
   04912 GnRH signaling pathway
    102495954 (PRKCA)
   04921 Oxytocin signaling pathway
    102495954 (PRKCA)
   04926 Relaxin signaling pathway
    102495954 (PRKCA)
   04935 Growth hormone synthesis, secretion and action
    102495954 (PRKCA)
   04918 Thyroid hormone synthesis
    102495954 (PRKCA)
   04919 Thyroid hormone signaling pathway
    102495954 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    102495954 (PRKCA)
   04916 Melanogenesis
    102495954 (PRKCA)
   04925 Aldosterone synthesis and secretion
    102495954 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102495954 (PRKCA)
   04270 Vascular smooth muscle contraction
    102495954 (PRKCA)
  09154 Digestive system
   04970 Salivary secretion
    102495954 (PRKCA)
   04971 Gastric acid secretion
    102495954 (PRKCA)
   04972 Pancreatic secretion
    102495954 (PRKCA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102495954 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102495954 (PRKCA)
  09156 Nervous system
   04724 Glutamatergic synapse
    102495954 (PRKCA)
   04727 GABAergic synapse
    102495954 (PRKCA)
   04725 Cholinergic synapse
    102495954 (PRKCA)
   04728 Dopaminergic synapse
    102495954 (PRKCA)
   04726 Serotonergic synapse
    102495954 (PRKCA)
   04720 Long-term potentiation
    102495954 (PRKCA)
   04730 Long-term depression
    102495954 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    102495954 (PRKCA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102495954 (PRKCA)
  09158 Development and regeneration
   04360 Axon guidance
    102495954 (PRKCA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102495954 (PRKCA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102495954 (PRKCA)
   05206 MicroRNAs in cancer
    102495954 (PRKCA)
   05205 Proteoglycans in cancer
    102495954 (PRKCA)
   05231 Choline metabolism in cancer
    102495954 (PRKCA)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102495954 (PRKCA)
   05214 Glioma
    102495954 (PRKCA)
   05223 Non-small cell lung cancer
    102495954 (PRKCA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    102495954 (PRKCA)
   05022 Pathways of neurodegeneration - multiple diseases
    102495954 (PRKCA)
  09165 Substance dependence
   05031 Amphetamine addiction
    102495954 (PRKCA)
   05032 Morphine addiction
    102495954 (PRKCA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102495954 (PRKCA)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102495954 (PRKCA)
   05164 Influenza A
    102495954 (PRKCA)
   05161 Hepatitis B
    102495954 (PRKCA)
   05163 Human cytomegalovirus infection
    102495954 (PRKCA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102495954 (PRKCA)
   05143 African trypanosomiasis
    102495954 (PRKCA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102495954 (PRKCA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tup01001]
    102495954 (PRKCA)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tup04131]
    102495954 (PRKCA)
Enzymes [BR:tup01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     102495954 (PRKCA)
Protein kinases [BR:tup01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   102495954 (PRKCA)
Membrane trafficking [BR:tup04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    102495954 (PRKCA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 APH
Other DBs
NCBI-GeneID: 102495954
NCBI-ProteinID: XP_006146824
LinkDB
Position
Un
AA seq 672 aa
MADVFPANDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVSDEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDDEGNAE
LRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVN
PQFVHPILQSAV
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggctgacgttttcccggccaacgactccacggcgtctcaggacgtggccaaccgcttc
gcccgcaaaggggcgctgaggcagaagaacgtgcacgaggtgaaggaccacaaattcatc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctgggggttt
gggaaacaaggcttccagtgccaagtttgctgttttgtggtccacaagaggtgccatgag
tttgttacattttcttgtcctggtgcggataaggggcctgacactgacgaccccagaagc
aagcacaagtttaaaatccacacttatggaagccccaccttctgcgatcactgtgggtca
ctgctgtatggactcatccaccaggggatgaaatgtgacacctgcgatatgaatgttcac
aagcagtgtgtaataaacgtccccagcctctgtgggatggatcacacggagaagagggga
cggatttacctgaaggccgaggtctccgatgaaaagctgcacgtcacagtacgagatgca
aaaaacctaatccctatggatccaaatgggctttcagacccttacgtgaagctgaaactt
atccccgatcccaagaatgaaagcaaacagaaaaccaaaaccatccgctccacactaaac
ccccagtggaatgagtccttcaccttcaaattaaaaccttcagacaaagaccggcgactg
tctgtagaaatttgggactgggatcgaactacaaggaatgatttcatgggatccctgtcc
tttggagtgtcggagctaatgaagatgccagccagtggatggtacaagttgcttaaccag
gaagaaggcgagtactacaacgtacccattccggaaggggacgacgaaggaaacgcggag
ctcaggcagaagttcgagaaagccaagcttggcccggctggcaacaaagtcatcagccct
tcagaagaccggaaacagccttccaacaacctggaccgagtgaaactcaccgacttcaat
ttccttatggtgctggggaaggggagttttggaaaggtgatgctcgctgacaggaagggg
accgaggaactgtatgcgatcaaaatcctgaagaaggacgtggtgattcaggatgacgac
gtggagtgcaccatggtggagaagcgggtgctggccctgctggacaagccgccgttcctg
acgcagctgcactcctgcttccagacggtggatcgcctgtactttgtcatggaatacgtc
aacggcggggacctcatgtaccacattcagcaagtggggaagtttaaggagccacaggca
gtattctatgcagcagagatttccatcggcttgttctttcttcataaaagaggaatcatt
tatagggatctgaagttagataatgtcatgctggattcagaaggacacatcaaaattgct
gacttcgggatgtgcaaggagcacatgatggacggagtcacaaccaggaccttctgtggg
actccagactacatcgccccggagataatcgcttatcagccgtatggaaaatctgtggac
tggtgggcctatggcgtcctgttgtatgagatgctagccgggcagcctccattcgacggc
gaggatgaggatgagctgtttcagtctatcatggagcacaacgtctcctacccaaagtcc
ctgtccaaggaggccgtgtccatctgcaaaggactgatgaccaaacacccggccaagcgg
ctgggctgcggccccgagggcgagagggatgtacgagaacacgccttcttccggaggatc
gactgggagaaactggagaaccgggagatccagccaccgttcaagcccaaagtgtgcggc
aaaggagcggaaaacttcgacaagttcttcacacgagggcaacctgtcctaacgccgcct
gatcagctggtcatcgctaacatagaccagtctgattttgaaggcttctcatatgtcaac
ccccagttcgtgcaccccatcttacagagcgcagtatga

KEGG   Tupaia chinensis (Chinese tree shrew): 102497204
Entry
102497204         CDS       T02978                                 

Gene name
PRKCG
Definition
(RefSeq) protein kinase C gamma
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01521  EGFR tyrosine kinase inhibitor resistance
tup04010  MAPK signaling pathway
tup04012  ErbB signaling pathway
tup04014  Ras signaling pathway
tup04015  Rap1 signaling pathway
tup04020  Calcium signaling pathway
tup04066  HIF-1 signaling pathway
tup04070  Phosphatidylinositol signaling system
tup04071  Sphingolipid signaling pathway
tup04150  mTOR signaling pathway
tup04270  Vascular smooth muscle contraction
tup04310  Wnt signaling pathway
tup04370  VEGF signaling pathway
tup04510  Focal adhesion
tup04540  Gap junction
tup04650  Natural killer cell mediated cytotoxicity
tup04666  Fc gamma R-mediated phagocytosis
tup04670  Leukocyte transendothelial migration
tup04713  Circadian entrainment
tup04720  Long-term potentiation
tup04723  Retrograde endocannabinoid signaling
tup04724  Glutamatergic synapse
tup04725  Cholinergic synapse
tup04726  Serotonergic synapse
tup04727  GABAergic synapse
tup04728  Dopaminergic synapse
tup04730  Long-term depression
tup04750  Inflammatory mediator regulation of TRP channels
tup04911  Insulin secretion
tup04916  Melanogenesis
tup04918  Thyroid hormone synthesis
tup04919  Thyroid hormone signaling pathway
tup04921  Oxytocin signaling pathway
tup04925  Aldosterone synthesis and secretion
tup04928  Parathyroid hormone synthesis, secretion and action
tup04929  GnRH secretion
tup04935  Growth hormone synthesis, secretion and action
tup04960  Aldosterone-regulated sodium reabsorption
tup04961  Endocrine and other factor-regulated calcium reabsorption
tup04970  Salivary secretion
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup05017  Spinocerebellar ataxia
tup05022  Pathways of neurodegeneration - multiple diseases
tup05031  Amphetamine addiction
tup05032  Morphine addiction
tup05143  African trypanosomiasis
tup05146  Amoebiasis
tup05161  Hepatitis B
tup05163  Human cytomegalovirus infection
tup05170  Human immunodeficiency virus 1 infection
tup05200  Pathways in cancer
tup05205  Proteoglycans in cancer
tup05206  MicroRNAs in cancer
tup05214  Glioma
tup05223  Non-small cell lung cancer
tup05225  Hepatocellular carcinoma
tup05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102497204 (PRKCG)
   04012 ErbB signaling pathway
    102497204 (PRKCG)
   04014 Ras signaling pathway
    102497204 (PRKCG)
   04015 Rap1 signaling pathway
    102497204 (PRKCG)
   04310 Wnt signaling pathway
    102497204 (PRKCG)
   04370 VEGF signaling pathway
    102497204 (PRKCG)
   04066 HIF-1 signaling pathway
    102497204 (PRKCG)
   04020 Calcium signaling pathway
    102497204 (PRKCG)
   04070 Phosphatidylinositol signaling system
    102497204 (PRKCG)
   04071 Sphingolipid signaling pathway
    102497204 (PRKCG)
   04150 mTOR signaling pathway
    102497204 (PRKCG)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102497204 (PRKCG)
   04540 Gap junction
    102497204 (PRKCG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102497204 (PRKCG)
   04666 Fc gamma R-mediated phagocytosis
    102497204 (PRKCG)
   04670 Leukocyte transendothelial migration
    102497204 (PRKCG)
  09152 Endocrine system
   04911 Insulin secretion
    102497204 (PRKCG)
   04929 GnRH secretion
    102497204 (PRKCG)
   04921 Oxytocin signaling pathway
    102497204 (PRKCG)
   04935 Growth hormone synthesis, secretion and action
    102497204 (PRKCG)
   04918 Thyroid hormone synthesis
    102497204 (PRKCG)
   04919 Thyroid hormone signaling pathway
    102497204 (PRKCG)
   04928 Parathyroid hormone synthesis, secretion and action
    102497204 (PRKCG)
   04916 Melanogenesis
    102497204 (PRKCG)
   04925 Aldosterone synthesis and secretion
    102497204 (PRKCG)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102497204 (PRKCG)
  09154 Digestive system
   04970 Salivary secretion
    102497204 (PRKCG)
   04971 Gastric acid secretion
    102497204 (PRKCG)
   04972 Pancreatic secretion
    102497204 (PRKCG)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102497204 (PRKCG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102497204 (PRKCG)
  09156 Nervous system
   04724 Glutamatergic synapse
    102497204 (PRKCG)
   04727 GABAergic synapse
    102497204 (PRKCG)
   04725 Cholinergic synapse
    102497204 (PRKCG)
   04728 Dopaminergic synapse
    102497204 (PRKCG)
   04726 Serotonergic synapse
    102497204 (PRKCG)
   04720 Long-term potentiation
    102497204 (PRKCG)
   04730 Long-term depression
    102497204 (PRKCG)
   04723 Retrograde endocannabinoid signaling
    102497204 (PRKCG)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102497204 (PRKCG)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102497204 (PRKCG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102497204 (PRKCG)
   05206 MicroRNAs in cancer
    102497204 (PRKCG)
   05205 Proteoglycans in cancer
    102497204 (PRKCG)
   05231 Choline metabolism in cancer
    102497204 (PRKCG)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102497204 (PRKCG)
   05214 Glioma
    102497204 (PRKCG)
   05223 Non-small cell lung cancer
    102497204 (PRKCG)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    102497204 (PRKCG)
   05022 Pathways of neurodegeneration - multiple diseases
    102497204 (PRKCG)
  09165 Substance dependence
   05031 Amphetamine addiction
    102497204 (PRKCG)
   05032 Morphine addiction
    102497204 (PRKCG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102497204 (PRKCG)
   05161 Hepatitis B
    102497204 (PRKCG)
   05163 Human cytomegalovirus infection
    102497204 (PRKCG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102497204 (PRKCG)
   05143 African trypanosomiasis
    102497204 (PRKCG)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102497204 (PRKCG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tup01001]
    102497204 (PRKCG)
Enzymes [BR:tup01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     102497204 (PRKCG)
Protein kinases [BR:tup01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   102497204 (PRKCG)
SSDB
Motif
Pfam: Pkinase C1_1 PK_Tyr_Ser-Thr C2 Pkinase_C Kinase-like
Other DBs
NCBI-GeneID: 102497204
NCBI-ProteinID: XP_006144820
LinkDB
Position
Un
AA seq 780 aa
MCPALAGRRKQPCWPKAVPPGFPKHPGCPLLSGPSRCSRLFSIASVSALFSSILGQTTPT
RPVAVACLQSRERRKDSRLDCYGKGERAAHAEKSEGGPRPLFCRKGALRQKVVHEVKSHK
FTARFFKQPTFCSHCTDFIWGIGKQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDP
RNKHKFRLHTYSSPTFCDHCGSLLYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTER
RGRLQLEIRAPTADEIHITVGEARNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKA
TLNPVWNETFVFNLKPGDVERRLSVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKL
LNQEEGEYYNVPVADADNCSLLQKFEACNYPLELYERVRMGPSSSPVPSPSPSPTDPKRC
FFGASPGRLHISDFSFLMVLGKGSFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTL
VEKRVLALGGRGPGGRPHFLTQLHSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHA
AFYAAEIAIGLFFLHNQGIIYRDLKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCG
TPDYIAPEIIAYQPYGKSVDWWSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKS
LSREAVAICKGFLTKHPGKRLGSGPDGEPTIRAHGFFRWIDWERLERLEIAPPFRPRPCG
RSGENFDKFFTRAAPALTPPDRLVLASIDQSDFQGFTYVNPDFVHPDARNPPSPAPVPVM
NT seq 2343 nt   +upstreamnt  +downstreamnt
atgtgtcctgctctggcggggagacgaaaacagccctgctggccgaaagctgttcctcct
ggcttccccaagcacccgggctgccctttgctctccggcccgtccaggtgcagccggctg
ttctctatcgcgtctgtgtctgccctcttctccagcatcctgggccagaccacaccgacc
cgccctgtggctgtggcctgcctgcagagtagggaacggaggaaggacagccggcttgac
tgctatggcaaaggcgagcgggcagctcatgccgagaagtctgagggcggcccccggccc
ctgttctgcagaaagggggctctgagacagaaggtggtccatgaagtcaagagccacaag
ttcaccgcccgcttcttcaagcagccgaccttctgcagccactgcaccgacttcatctgg
ggcatcggaaagcagggcctgcaatgtcaagtctgcagctttgtggtccatcggcgatgc
cacgaatttgtgaccttcgagtgcccaggcgctggcaagggcccccagacagacgacccc
cggaacaagcacaagttccgcctgcacacctacagcagccccaccttctgcgaccactgc
ggctccctgctttacgggctggtgcaccagggcatgaagtgctcgtgctgcgagatgaac
gtgcaccggcgctgtgtgcgcagcgtgccttccctgtgcggtgtggaccacacggagcgc
cgtgggcgcctgcagctggaaatccgggctccgaccgcggatgagatccacatcacggtc
ggtgaggcccgaaacctcattccaatggaccctaacggtctgtccgatccctacgtgaaa
ctgaagctcatcccagaccctcggaacctaacgaaacagaagacccggacggtgaaagcc
acgctaaaccctgtgtggaacgagaccttcgtgttcaacttgaagccaggggatgtggag
cgcaggctcagcgtggaggtgtgggactgggaccggacctcccgcaacgacttcatgggc
gccatgtccttcggagtctcagagctgctcaaggcgcctgtggatggctggtacaagtta
ctgaaccaggaggagggcgagtattacaacgtgccagtggcggacgcggacaactgcagc
cttctccagaagttcgaggcctgcaactaccccctggaactgtacgagcgggtgcggatg
ggcccctcttcctctcctgtcccctccccgtcgcccagccccactgaccccaagcgctgc
ttctttggggccagccccggacgcctgcacatctcagacttcagcttcctcatggttctg
ggaaaaggcagttttgggaaggtgatgctggccgagcgcaggggctccgacgagctctac
gccatcaagatcctgaaaaaggacgtcatcgtccaagatgacgacgtggactgcacgctg
gtggagaagcgcgtgctggcgctcggcggccgcgggcctggcggccggccccacttcctc
acccagctccactccaccttccagaccccggaccgcctgtacttcgtgatggagtacgtc
accgggggggacctgatgtaccacattcagcagctgggcaagttcaaggagccccacgca
gcgttctacgctgctgaaatcgccatcggcctcttcttcctgcacaaccaggggatcatc
tacagggacctgaagctggacaacgtgatgctggacgccgaggggcacatcaagatcacc
gacttcggcatgtgcaaggagaacgtcttccccgggacgacgacccgcaccttctgcggg
acccccgactacatagcccccgagatcatcgcctaccagccctatgggaagtctgtcgac
tggtggtcctttggggtcctgctgtatgagatgttggcgggacagcctcccttcgacggg
gaggacgaggaggaactgttccaggccatcatggaacagacggtcacctaccccaagtcg
ctgtcgagggaagccgtggccatctgcaaggggttcctgaccaagcacccggggaagcgt
ctgggctccgggccagatggggagcccaccatccgggcgcacggctttttccgctggatt
gactgggagcggctggaacgcctggagatcgcccctccgttcagaccccggccgtgtggc
cgcagcggcgagaacttcgacaagtttttcacgcgcgcggcgccagcgctgacgccccca
gaccgcctcgtcctggccagcatcgaccagtcggatttccagggcttcacctacgtgaac
ccggatttcgtgcacccggatgcccgcaacccccccagcccagcgccagtgccggtcatg
taa

DBGET integrated database retrieval system