KEGG   Tupaia chinensis (Chinese tree shrew): 102469399
Entry
102469399         CDS       T02978                                 

Gene name
AXIN1, Axin-1
Definition
(RefSeq) axin 1
  KO
K02157  axin 1
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04310  Wnt signaling pathway
tup04390  Hippo signaling pathway
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04934  Cushing syndrome
tup05010  Alzheimer disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05165  Human papillomavirus infection
tup05200  Pathways in cancer
tup05210  Colorectal cancer
tup05213  Endometrial cancer
tup05217  Basal cell carcinoma
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102469399 (AXIN1)
   04390 Hippo signaling pathway
    102469399 (AXIN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102469399 (AXIN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102469399 (AXIN1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102469399 (AXIN1)
   05225 Hepatocellular carcinoma
    102469399 (AXIN1)
   05226 Gastric cancer
    102469399 (AXIN1)
   05217 Basal cell carcinoma
    102469399 (AXIN1)
   05213 Endometrial cancer
    102469399 (AXIN1)
   05224 Breast cancer
    102469399 (AXIN1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102469399 (AXIN1)
   05022 Pathways of neurodegeneration - multiple diseases
    102469399 (AXIN1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102469399 (AXIN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102469399 (AXIN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tup01009]
    102469399 (AXIN1)
Protein phosphatases and associated proteins [BR:tup01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102469399 (AXIN1)
SSDB
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind Rootletin
Other DBs
NCBI-GeneID: 102469399
NCBI-ProteinID: XP_006146404
LinkDB
Position
Un
AA seq 858 aa
MSVQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDPRPASHSSCSGRGASAKGETSTAT
PRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGIGLFRTFLKQEGCADLLDFWFA
CSGFRKLEPCDANEEKRLKLARAICRKYILDSSGIVSRQTKPATRSFIKDCIVRQQVDPA
MFDQAQTEVQAAMEENTYPSFLKSDMYLEYARTGAESPKGLGDQSPGSGAGKGLAGYLPT
LNEDEEWKCDPDIDEDEGRDTAPPSRLTQKLLLETAAPRASSSRRCSEGREFRYGPWREP
VNPYYVSSGYALAPATSANDSEQQSLSSDADSLSLTDSSVDGVPPYRTRRQHRREMQESM
QANGRGPLPHIPRTYRVPKEIRVEPHKFAEELIHRLEAVQRTREAEERLEERLRRVRMEE
EGEDGDLSPCPPGVSHKLPPAPTWHPFPPRYGDMGCAGLRDSHEEDPEAILDEHVQRVLR
TPGRQSPDSGHMAKGAAVLGGPTSGHSKHTPRSGPRLEAAGLHHHRHVHHHVHHSTARPK
EQVEAEAARRVQGSFPWGPELYGHAAKPRSYPESMGAGAGDSLTHSGKAGLPSRRGAKKA
DSGKSGSVEAPGPSEDAERNQKIMQWIIEGEKEISRHRRAGHGSSGVRKQPTHEGTRPLS
VERPGAVHPWVSAQLRNSVQPSHLFIQDPAMPPNPAPNPLTQLEEARRRLEEEEKRASKL
PSKQRYVQEVMQRGRTCARPACTAVLSGVPAVSDTELSETETKPQRKAGSGGAPPCDSIV
VAYYFCGEPIPYRTLVRGRTVTLGQFKELLTKRGSYRYYFKKVSDEFDCGVVFEEVREDE
AVLPVFEEKIIGKVEKVD
NT seq 2577 nt   +upstreamnt  +downstreamnt
atgagtgtccaagagcagggtttccctttggaccttggagcaagttttacggaagatgcc
ccccgacccccagtgcctggcgaggagggggagctggtgtccacagacccgaggcccgcc
agccacagttcctgctccgggagaggtgccagcgccaaaggcgagacttccaccgccacc
cctcggcgctcggacttggacctggggtacgagcccgagggcagcgcctcccccacgccg
ccctacctgaagtgggccgagtcgctgcactccctgctggacgaccaggacggcatcggc
ctgttccggaccttcctgaagcaggagggctgtgccgacctgctggacttctggttcgcc
tgcagcggcttcaggaagctggagccctgcgatgcgaacgaggagaagcggctgaagctg
gccagggccatctgccgcaagtacattctggacagcagcggcatcgtgtcccggcagacc
aagccggccaccaggagcttcatcaaggactgcatcgtgaggcagcaggtggaccccgcc
atgttcgaccaggcgcagacggaggtccaggctgccatggaggagaacacctacccctcg
ttcctcaagtctgacatgtacttggagtacgccaggacgggagcggagagcccgaagggc
ctcggcgaccagagccctgggtcaggggcgggcaagggcttggcggggtacctgcccacc
ttgaacgaagacgaggagtggaagtgtgacccggacatagatgaggacgagggcagagac
acggccccccccagcaggctcacgcagaagctgctcctggagacggccgccccgagggcc
tcctcgagcagacggtgcagcgaaggcagagagttcaggtatggaccgtggcgggagcca
gtcaacccctactacgtcagctccggctatgccttggccccggccaccagcgccaatgac
agcgagcagcagagtctatcaagcgatgccgacagcttgtccctcacagacagcagcgtg
gacggggtcccgccataccggacccgcaggcagcaccgcagggagatgcaggagagcatg
caggccaatgggcgggggcctctccctcacatccctcgcacctaccgcgtgccaaaggag
atccgcgtggagccacacaagtttgccgaggagctcatccaccggctagaagcagtccag
cgcacacgggaggccgaggagaggctggaggagcggctgaggcgtgtgcggatggaagaa
gaaggcgaggatggggacctgtctccttgtcctccgggagtgagtcacaagctgcctccc
gccccgacctggcaccccttcccgccccgctacggggacatgggctgtgctgggctgcgg
gactcgcacgaggaggaccctgaggccatcctggatgagcacgtgcagcgtgtgctgagg
acgcccggccgccagtcccctgacagcgggcacatggccaagggggcggcagtgctgggc
ggcccgacctctgggcacagcaagcacacgcccaggtcagggccaaggctggaggcggct
ggcctgcaccaccacaggcacgtccaccaccacgtccaccacagcacggccaggcccaag
gagcaggtggaggctgaggctgcccgcagggtccagggcagcttcccgtggggccccgaa
ctgtacggccacgcggccaagccccgcagctacccagagagcatgggtgccggtgctggt
gacagtctgacccacagcgggaaggcaggcttaccttccaggaggggcgccaagaaggcc
gactcggggaagagtggcagtgtggaggcccccgggccctcggaggacgcagagaggaac
cagaagatcatgcagtggatcatcgagggcgagaaggagatcagcaggcacaggagggct
ggccacgggtcttccggggtgaggaagcagccgacccatgagggtaccaggcctctgtcc
gttgagcgtccgggggctgtgcacccttgggtcagtgctcagctccggaactccgtccag
ccctcccacctcttcatccaagaccctgcaatgccacccaacccagcacccaaccccctg
acccagctggaggaggcccgcaggcgtctggaggaggaggagaagagggcgagcaagcta
ccctccaagcagaggtatgtgcaggaggttatgcagcggggacgcacctgcgccaggcca
gcgtgcacggcagtgctaagtggggtgcccgccgtgtcggacacggagctctccgagaca
gagacgaagccgcagaggaaggcgggcagcgggggcgccccgccctgtgacagcatcgtg
gtggcttactacttctgtggggagcccatcccctaccggaccctggtgaggggccgcacg
gtcaccctgggccagttcaaggagctgctgaccaagaggggcagttacagatactacttc
aagaaagtgagcgacgagttcgactgcggcgtggtgttcgaggaagtgcgggaagacgag
gccgtcctgcccgtgttcgaggagaagatcattggcaaagtggagaaggtggactga

KEGG   Tupaia chinensis (Chinese tree shrew): 102493766
Entry
102493766         CDS       T02978                                 

Gene name
AXIN2, Axin-2
Definition
(RefSeq) axin 2
  KO
K04385  axin 2
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04310  Wnt signaling pathway
tup04390  Hippo signaling pathway
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04934  Cushing syndrome
tup05010  Alzheimer disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05165  Human papillomavirus infection
tup05200  Pathways in cancer
tup05210  Colorectal cancer
tup05213  Endometrial cancer
tup05217  Basal cell carcinoma
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102493766 (AXIN2)
   04390 Hippo signaling pathway
    102493766 (AXIN2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102493766 (AXIN2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102493766 (AXIN2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102493766 (AXIN2)
   05225 Hepatocellular carcinoma
    102493766 (AXIN2)
   05226 Gastric cancer
    102493766 (AXIN2)
   05217 Basal cell carcinoma
    102493766 (AXIN2)
   05213 Endometrial cancer
    102493766 (AXIN2)
   05224 Breast cancer
    102493766 (AXIN2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102493766 (AXIN2)
   05022 Pathways of neurodegeneration - multiple diseases
    102493766 (AXIN2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102493766 (AXIN2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102493766 (AXIN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tup03036]
    102493766 (AXIN2)
Chromosome and associated proteins [BR:tup03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    102493766 (AXIN2)
SSDB
Motif
Pfam: RGS DIX AXIN1_TNKS_BD Axin_b-cat_bind SdrD_B
Other DBs
NCBI-GeneID: 102493766
NCBI-ProteinID: XP_014442651
LinkDB
Position
Un
AA seq 841 aa
MSSAVLVPRLPDHSSSFREDAPRPPVPGEEGEAPPCQFGVGKGQVTKPMPVSSNARRNED
GLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQM
NLKDTKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQIDSVMFDQAQTEIQA
VMEENAYQMFLTSDIYLEYVRSGGENTAYMGNGGLGSLKVVCGYLPTLNEEEEWTCADFK
CKLSPTVVGLSSKTLKATASVRSTETVENGYRSFKRSDPVNPYHVGSGYVFAPATSANDS
EISSDALTDDSMSMTDSSVDGIPPYRMGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPK
EMTPVDPATFAAELISRLEKLKLELESRHSLEERLQQIREDEEKEGPELALSSREGAPTQ
HPLSLLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGMGRYSPRSRSPDQHQQLQQQYHLL
LPPGAKLPPTATSAGTFPLLGGKGFVTKQTTKHVHHHYIHHHAVAKTKEEIEAEATQRVR
CFCPGGGEYYCSKCKSHAKATEPTPGCQLGGSRGSTLPKRSGKGMEPGQALPTREGGASG
GAGALQLPGEEGDRSQDVWQWMLESERQSRAQPFSTQSTKKTCPLESARTSPGERPSRHH
LWGGSGHSRATPRAHPFTQDPTMPPLTPPNTLAQLEEACRRLAEVSKPPKQRCCVTSQQR
DRSHSATGQAGATPFSIPSLAPEDHKEPKKLPGVHMLQASELVVTYFFCGEEIPYRRMLK
AQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWDDETVLPMYEGRILGKVERI
D
NT seq 2526 nt   +upstreamnt  +downstreamnt
atgagcagcgctgtattggtgccacgcctcccggaccacagcagcagcttccgagaggat
gccccgcggcccccggttcccggggaagaaggggaggccccaccgtgccagttcggagtg
ggcaagggtcaggtcaccaaacccatgcctgtctcctccaatgccaggcggaacgaagat
gggctaggggagcccgaggggcgggcgtccccggattcccctctgaccaggtggaccaag
tctttgcactccttgttgggcgatcaagacggtgcttacctcttccggactttcctggag
agggagaaatgtgtggataccttagacttctggtttgcctgcaatggattccggcagatg
aacctgaaggataccaaaactttacgagtagccaaagcgatctacaaaaggtacatcgag
aacaacagcattgtctccaagcagctgaaacctgccaccaagacctacataagagacggc
atcaaaaagcagcagattgattcggtcatgtttgaccaagcgcagactgagattcaggct
gtgatggaagaaaatgcctaccagatgtttttgacctccgacatataccttgagtatgtg
aggagtgggggagaaaacacagcttacatgggtaatgggggactggggagcctcaaagtc
gtgtgtggctacctccccaccttgaatgaagaagaggaatggacttgtgcagatttcaag
tgcaaactgtcacccacagtggttggcttgtccagcaaaactctaaaggctacggcaagt
gtgaggtccacagagactgtagaaaatggatacaggtctttcaagaggagcgatcctgtt
aatccgtatcacgtaggttctggctacgtctttgcaccagccaccagtgccaatgacagt
gagatatccagtgacgcactgaccgacgattccatgtccatgacggacagtagcgtagat
ggaatccctccttatcgcatggggagtaagaagcagctccagagagaaatgcatcgcagt
gtgaaggccaatggccaagtgtctctacctcatttcccgagaacccaccgcctgcccaag
gagatgacccccgtggaccccgccacctttgcggccgagctgatctcgaggctggagaag
ctgaagctggagctggagagccgccacagcctggaggagcgcctgcagcagatccgggag
gatgaagagaaagaggggcctgagctggcactgagctcgcgagagggggcgcccacccag
catcccctctccctgctgccctctggcagctacgaggaggaccctcagaccattctggac
gaccacctgtctagggtcctcaagaccccaggctgccagtcgccaggcatgggccgctac
agcccccgctcccgctcccccgaccagcaccagcagctgcagcagcagtaccacctcctc
ctccctcccggggccaagctgccccccactgccacctcagcaggcaccttccccctgctc
gggggcaagggctttgtgaccaagcagacgacgaaacatgtccaccatcattacatccac
caccacgccgtcgccaagaccaaggaggagattgaggcggaagccacacagcgggtgcgc
tgcttctgccccgggggcggcgagtactactgctccaagtgcaagagtcacgccaaggcc
accgagcccacgccagggtgccagttaggcggcagcagaggcagtaccttgcccaaacgg
agtgggaaaggcatggagccgggccaggccctgcccaccagggaaggaggggcttccggc
ggagctggggccctgcagcttcccggggaggaaggagacaggtcgcaggatgtctggcag
tggatgctggagagtgagcggcagagcagggcccagccattcagcacccaaagcacaaag
aagacctgtcccttggagtctgcccgcacgtccccaggcgaacgacccagccggcaccac
ctgtgggggggcagcgggcactctcgtgccaccccccgcgcccatccgtttacccaggac
cctacgatgcctcccttgaccccacccaacaccctggcgcagctggaggaggcctgccgc
aggctggctgaggtgtcgaagccccccaaacagcggtgctgcgtgaccagccagcagagg
gacaggagccactcggccactggtcaggcaggagccacgcccttctcgatccccagcctg
gctccagaagatcacaaagagccaaagaaactgccaggtgttcacatgctccaggccagc
gagttggttgtcacttactttttctgcggagaagaaattccatacaggaggatgctgaag
gctcaaagcttgaccctgggccattttaaagagcagctcagcaaaaagggaaactatagg
tattactttaaaaaagccagtgatgaatttgcctgtggagcagtgtttgaggagatctgg
gatgacgagacggtgctccccatgtacgaaggcaggatcctgggcaaagtggagcggatc
gattga

DBGET integrated database retrieval system