KEGG   Tupaia chinensis (Chinese tree shrew): 102469401
Entry
102469401         CDS       T02978                                 

Gene name
PIK3R2
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 2
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01521  EGFR tyrosine kinase inhibitor resistance
tup01522  Endocrine resistance
tup01524  Platinum drug resistance
tup04012  ErbB signaling pathway
tup04014  Ras signaling pathway
tup04015  Rap1 signaling pathway
tup04024  cAMP signaling pathway
tup04062  Chemokine signaling pathway
tup04066  HIF-1 signaling pathway
tup04068  FoxO signaling pathway
tup04070  Phosphatidylinositol signaling system
tup04071  Sphingolipid signaling pathway
tup04072  Phospholipase D signaling pathway
tup04140  Autophagy - animal
tup04150  mTOR signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04152  AMPK signaling pathway
tup04210  Apoptosis
tup04211  Longevity regulating pathway
tup04213  Longevity regulating pathway - multiple species
tup04218  Cellular senescence
tup04360  Axon guidance
tup04370  VEGF signaling pathway
tup04380  Osteoclast differentiation
tup04510  Focal adhesion
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04611  Platelet activation
tup04613  Neutrophil extracellular trap formation
tup04620  Toll-like receptor signaling pathway
tup04625  C-type lectin receptor signaling pathway
tup04630  JAK-STAT signaling pathway
tup04650  Natural killer cell mediated cytotoxicity
tup04660  T cell receptor signaling pathway
tup04662  B cell receptor signaling pathway
tup04664  Fc epsilon RI signaling pathway
tup04666  Fc gamma R-mediated phagocytosis
tup04668  TNF signaling pathway
tup04670  Leukocyte transendothelial migration
tup04722  Neurotrophin signaling pathway
tup04725  Cholinergic synapse
tup04750  Inflammatory mediator regulation of TRP channels
tup04810  Regulation of actin cytoskeleton
tup04910  Insulin signaling pathway
tup04914  Progesterone-mediated oocyte maturation
tup04915  Estrogen signaling pathway
tup04917  Prolactin signaling pathway
tup04919  Thyroid hormone signaling pathway
tup04923  Regulation of lipolysis in adipocytes
tup04926  Relaxin signaling pathway
tup04929  GnRH secretion
tup04930  Type II diabetes mellitus
tup04931  Insulin resistance
tup04932  Non-alcoholic fatty liver disease
tup04933  AGE-RAGE signaling pathway in diabetic complications
tup04935  Growth hormone synthesis, secretion and action
tup04960  Aldosterone-regulated sodium reabsorption
tup04973  Carbohydrate digestion and absorption
tup05010  Alzheimer disease
tup05017  Spinocerebellar ataxia
tup05020  Prion disease
tup05100  Bacterial invasion of epithelial cells
tup05135  Yersinia infection
tup05142  Chagas disease
tup05146  Amoebiasis
tup05160  Hepatitis C
tup05161  Hepatitis B
tup05162  Measles
tup05163  Human cytomegalovirus infection
tup05164  Influenza A
tup05165  Human papillomavirus infection
tup05166  Human T-cell leukemia virus 1 infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05168  Herpes simplex virus 1 infection
tup05169  Epstein-Barr virus infection
tup05170  Human immunodeficiency virus 1 infection
tup05171  Coronavirus disease - COVID-19
tup05200  Pathways in cancer
tup05203  Viral carcinogenesis
tup05205  Proteoglycans in cancer
tup05206  MicroRNAs in cancer
tup05210  Colorectal cancer
tup05211  Renal cell carcinoma
tup05212  Pancreatic cancer
tup05213  Endometrial cancer
tup05214  Glioma
tup05215  Prostate cancer
tup05218  Melanoma
tup05220  Chronic myeloid leukemia
tup05221  Acute myeloid leukemia
tup05222  Small cell lung cancer
tup05223  Non-small cell lung cancer
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
tup05230  Central carbon metabolism in cancer
tup05231  Choline metabolism in cancer
tup05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tup05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102469401 (PIK3R2)
   04014 Ras signaling pathway
    102469401 (PIK3R2)
   04015 Rap1 signaling pathway
    102469401 (PIK3R2)
   04370 VEGF signaling pathway
    102469401 (PIK3R2)
   04630 JAK-STAT signaling pathway
    102469401 (PIK3R2)
   04668 TNF signaling pathway
    102469401 (PIK3R2)
   04066 HIF-1 signaling pathway
    102469401 (PIK3R2)
   04068 FoxO signaling pathway
    102469401 (PIK3R2)
   04070 Phosphatidylinositol signaling system
    102469401 (PIK3R2)
   04072 Phospholipase D signaling pathway
    102469401 (PIK3R2)
   04071 Sphingolipid signaling pathway
    102469401 (PIK3R2)
   04024 cAMP signaling pathway
    102469401 (PIK3R2)
   04151 PI3K-Akt signaling pathway
    102469401 (PIK3R2)
   04152 AMPK signaling pathway
    102469401 (PIK3R2)
   04150 mTOR signaling pathway
    102469401 (PIK3R2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102469401 (PIK3R2)
  09143 Cell growth and death
   04210 Apoptosis
    102469401 (PIK3R2)
   04218 Cellular senescence
    102469401 (PIK3R2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102469401 (PIK3R2)
   04550 Signaling pathways regulating pluripotency of stem cells
    102469401 (PIK3R2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102469401 (PIK3R2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102469401 (PIK3R2)
   04613 Neutrophil extracellular trap formation
    102469401 (PIK3R2)
   04620 Toll-like receptor signaling pathway
    102469401 (PIK3R2)
   04625 C-type lectin receptor signaling pathway
    102469401 (PIK3R2)
   04650 Natural killer cell mediated cytotoxicity
    102469401 (PIK3R2)
   04660 T cell receptor signaling pathway
    102469401 (PIK3R2)
   04662 B cell receptor signaling pathway
    102469401 (PIK3R2)
   04664 Fc epsilon RI signaling pathway
    102469401 (PIK3R2)
   04666 Fc gamma R-mediated phagocytosis
    102469401 (PIK3R2)
   04670 Leukocyte transendothelial migration
    102469401 (PIK3R2)
   04062 Chemokine signaling pathway
    102469401 (PIK3R2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102469401 (PIK3R2)
   04923 Regulation of lipolysis in adipocytes
    102469401 (PIK3R2)
   04929 GnRH secretion
    102469401 (PIK3R2)
   04915 Estrogen signaling pathway
    102469401 (PIK3R2)
   04914 Progesterone-mediated oocyte maturation
    102469401 (PIK3R2)
   04917 Prolactin signaling pathway
    102469401 (PIK3R2)
   04926 Relaxin signaling pathway
    102469401 (PIK3R2)
   04935 Growth hormone synthesis, secretion and action
    102469401 (PIK3R2)
   04919 Thyroid hormone signaling pathway
    102469401 (PIK3R2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102469401 (PIK3R2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102469401 (PIK3R2)
  09156 Nervous system
   04725 Cholinergic synapse
    102469401 (PIK3R2)
   04722 Neurotrophin signaling pathway
    102469401 (PIK3R2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102469401 (PIK3R2)
  09158 Development and regeneration
   04360 Axon guidance
    102469401 (PIK3R2)
   04380 Osteoclast differentiation
    102469401 (PIK3R2)
  09149 Aging
   04211 Longevity regulating pathway
    102469401 (PIK3R2)
   04213 Longevity regulating pathway - multiple species
    102469401 (PIK3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102469401 (PIK3R2)
   05206 MicroRNAs in cancer
    102469401 (PIK3R2)
   05205 Proteoglycans in cancer
    102469401 (PIK3R2)
   05203 Viral carcinogenesis
    102469401 (PIK3R2)
   05230 Central carbon metabolism in cancer
    102469401 (PIK3R2)
   05231 Choline metabolism in cancer
    102469401 (PIK3R2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102469401 (PIK3R2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102469401 (PIK3R2)
   05212 Pancreatic cancer
    102469401 (PIK3R2)
   05225 Hepatocellular carcinoma
    102469401 (PIK3R2)
   05226 Gastric cancer
    102469401 (PIK3R2)
   05214 Glioma
    102469401 (PIK3R2)
   05221 Acute myeloid leukemia
    102469401 (PIK3R2)
   05220 Chronic myeloid leukemia
    102469401 (PIK3R2)
   05218 Melanoma
    102469401 (PIK3R2)
   05211 Renal cell carcinoma
    102469401 (PIK3R2)
   05215 Prostate cancer
    102469401 (PIK3R2)
   05213 Endometrial cancer
    102469401 (PIK3R2)
   05224 Breast cancer
    102469401 (PIK3R2)
   05222 Small cell lung cancer
    102469401 (PIK3R2)
   05223 Non-small cell lung cancer
    102469401 (PIK3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102469401 (PIK3R2)
   05017 Spinocerebellar ataxia
    102469401 (PIK3R2)
   05020 Prion disease
    102469401 (PIK3R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102469401 (PIK3R2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102469401 (PIK3R2)
   04932 Non-alcoholic fatty liver disease
    102469401 (PIK3R2)
   04931 Insulin resistance
    102469401 (PIK3R2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102469401 (PIK3R2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102469401 (PIK3R2)
   05100 Bacterial invasion of epithelial cells
    102469401 (PIK3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102469401 (PIK3R2)
   05170 Human immunodeficiency virus 1 infection
    102469401 (PIK3R2)
   05161 Hepatitis B
    102469401 (PIK3R2)
   05160 Hepatitis C
    102469401 (PIK3R2)
   05171 Coronavirus disease - COVID-19
    102469401 (PIK3R2)
   05164 Influenza A
    102469401 (PIK3R2)
   05162 Measles
    102469401 (PIK3R2)
   05168 Herpes simplex virus 1 infection
    102469401 (PIK3R2)
   05163 Human cytomegalovirus infection
    102469401 (PIK3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102469401 (PIK3R2)
   05169 Epstein-Barr virus infection
    102469401 (PIK3R2)
   05165 Human papillomavirus infection
    102469401 (PIK3R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102469401 (PIK3R2)
   05142 Chagas disease
    102469401 (PIK3R2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102469401 (PIK3R2)
   01524 Platinum drug resistance
    102469401 (PIK3R2)
   01522 Endocrine resistance
    102469401 (PIK3R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tup04131]
    102469401 (PIK3R2)
Membrane trafficking [BR:tup04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102469401 (PIK3R2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 Ribosomal_L22e SH3_2 Tai4
Other DBs
NCBI-GeneID: 102469401
NCBI-ProteinID: XP_014442807
LinkDB
Position
Un
AA seq 729 aa
MAGAEGFQYRALYPFRRERPEDLELLPGDVLVVTRAALQALGVAEGGERCPQSVGWIPGF
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPRDGPPEPGPTLPDLAEQFCP
PDAAPPLLVKLVEAMERTGLDSESHYRPELPAPRTDWSLSDVDQWDAAALSDGIKSFLMA
LPAPLVTPEAAAEAHRALREAAGPVGPALEPPTLPLHRALTLRFLLQHLVRVARRAPASG
PAVRALGATFGPLLLRTPPPPSPPPGGAPDGNEPNPDFPALLVEKLLQEHLEEQEVAPPA
LPPKPPKAKPAPTGLANGGSTPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSKI
QGEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLITHYRHESLAQYNAKLDTRL
LYPVSKYQQDQIVKEDNVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAI
EAFNETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILMNSERLKSRIAEIHENRTK
LEQELRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINDWLGIKNET
EDQYALMEDEDDLPHHEEHTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVVV
DGDTKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPGP
GPGPPPATR
NT seq 2190 nt   +upstreamnt  +downstreamnt
atggcgggcgctgagggcttccagtaccgggcgctgtacccattccgccgggagcgaccg
gaggacctggaactgcttcccggggatgtgctggtggtgacccgggcggccctgcaggcc
ctgggggtggccgagggtggcgaacgctgcccacagagcgtgggttggatacccggcttc
aatgaacgcacgcgacagcgaggagacttccctggcacctacgtggaattcctggggcct
gtggccctggcccggcctggccctcgtccacgagggccccgaccgctgcccgccaggccc
cgagatgggccccctgagccaggccctaccctccccgacctggcggagcagttctgccca
ccggatgcggcaccccctcttctggtgaagttggtggaggccatggagcggacggggctg
gacagcgaatcgcactacaggccggagctgcccgccccgcggacagattggtccctgagc
gacgtggatcagtgggacgcggcagctctatccgatggcattaagagtttcctaatggcg
ctccctgcacccctcgtgacgcccgaagcagcggctgaggcgcaccgggctctccgagag
gctgcaggacccgtggggccggcgctggagcccccaacgctgccgctgcaccgagcactc
acgctgcgcttcctactccagcacttggtccgggtggcccgccgggccccagcttcgggc
cccgcggtccgagctctgggtgccacctttgggccgctgctgctacgcacgccgccaccg
ccctcgccaccgccagggggcgcgcccgacgggaacgagcccaaccccgacttcccagca
ctgctggtggagaagctgcttcaggaacatctggaagagcaagaggtcgcgcccccagca
ctgccacctaaaccccccaaggcaaagccggcccccacaggcctggccaatggggggagc
acaccctccctgcaggatgcggagtggtactggggagacatctccagggaggaagtgaat
gaaaaactgcgggacacgcctgatggcaccttcctagtccgagatgcatccagtaagatc
cagggagagtacacactgaccctcaggaaaggcggcaacaacaagctcattaaggtcttc
caccgggacgggcactatggcttctcggaaccgctcaccttctgctccgtcgtggacctc
atcacccactaccgccacgagtctctggcccagtacaacgctaagctggacacgcggctc
ctctaccccgtgtccaagtaccagcaggaccagatcgtcaaggaggacaacgtggaggcg
gtgggtgcccagctcaaagtctatcaccagcagtaccaggacaagagccgcgagtacgac
cagctgtatgaggagtacacgcggacctcgcaggaactacagatgaaacgcacagcaatc
gaggccttcaacgaaaccatcaagatctttgaagaacagggccagacgcaagagaagtgc
agcaaggaatatctggagcggttccggcgtgagggtaatgagaaggagatgcagagaatc
ctgatgaactcagagcggctcaaatctcgaatcgccgagatccatgagaaccgcaccaag
ttggagcaggagctgcgggcacaggcctcggacaaccgggagattgacaaacgcatgaac
agcctcaagcccgacctcatgcaactacgcaagatccgagaccagtacctcgtgtggctt
acccagaaaggagcccggcagaagaaaatcaacgactggttggggattaaaaatgaaacg
gaggaccagtacgccctgatggaagacgaggatgacctcccccatcacgaggaacacacg
tggtacgtgggcaagatcaaccggacccaggctgaagaaatgctgagtggcaagcgcgac
ggcaccttcctgatccgggagagcagccagcggggctgttacgcttgctcagtggtggta
gacggagacacgaagcactgcgtcatctaccgcacggccaccggcttcggcttcgcggag
ccctacaacctgtacgggtccctgaaggagctggtgctgcactatcagcacgcatcgctg
gtgcagcacaacgacgcgctcacggtcaccctggcccaccccgtgcgcgccccgggcccg
ggcccgggcccgccacctgccacgcgctga

KEGG   Tupaia chinensis (Chinese tree shrew): 102483329
Entry
102483329         CDS       T02978                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00562  Inositol phosphate metabolism
tup01100  Metabolic pathways
tup01521  EGFR tyrosine kinase inhibitor resistance
tup01522  Endocrine resistance
tup01524  Platinum drug resistance
tup04012  ErbB signaling pathway
tup04014  Ras signaling pathway
tup04015  Rap1 signaling pathway
tup04024  cAMP signaling pathway
tup04062  Chemokine signaling pathway
tup04066  HIF-1 signaling pathway
tup04068  FoxO signaling pathway
tup04070  Phosphatidylinositol signaling system
tup04071  Sphingolipid signaling pathway
tup04072  Phospholipase D signaling pathway
tup04140  Autophagy - animal
tup04150  mTOR signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04152  AMPK signaling pathway
tup04210  Apoptosis
tup04211  Longevity regulating pathway
tup04213  Longevity regulating pathway - multiple species
tup04218  Cellular senescence
tup04360  Axon guidance
tup04370  VEGF signaling pathway
tup04380  Osteoclast differentiation
tup04510  Focal adhesion
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04611  Platelet activation
tup04613  Neutrophil extracellular trap formation
tup04620  Toll-like receptor signaling pathway
tup04625  C-type lectin receptor signaling pathway
tup04630  JAK-STAT signaling pathway
tup04650  Natural killer cell mediated cytotoxicity
tup04660  T cell receptor signaling pathway
tup04662  B cell receptor signaling pathway
tup04664  Fc epsilon RI signaling pathway
tup04666  Fc gamma R-mediated phagocytosis
tup04668  TNF signaling pathway
tup04670  Leukocyte transendothelial migration
tup04722  Neurotrophin signaling pathway
tup04725  Cholinergic synapse
tup04750  Inflammatory mediator regulation of TRP channels
tup04810  Regulation of actin cytoskeleton
tup04910  Insulin signaling pathway
tup04914  Progesterone-mediated oocyte maturation
tup04915  Estrogen signaling pathway
tup04917  Prolactin signaling pathway
tup04919  Thyroid hormone signaling pathway
tup04923  Regulation of lipolysis in adipocytes
tup04926  Relaxin signaling pathway
tup04929  GnRH secretion
tup04930  Type II diabetes mellitus
tup04931  Insulin resistance
tup04932  Non-alcoholic fatty liver disease
tup04933  AGE-RAGE signaling pathway in diabetic complications
tup04935  Growth hormone synthesis, secretion and action
tup04960  Aldosterone-regulated sodium reabsorption
tup04973  Carbohydrate digestion and absorption
tup05010  Alzheimer disease
tup05017  Spinocerebellar ataxia
tup05020  Prion disease
tup05100  Bacterial invasion of epithelial cells
tup05132  Salmonella infection
tup05135  Yersinia infection
tup05142  Chagas disease
tup05146  Amoebiasis
tup05160  Hepatitis C
tup05161  Hepatitis B
tup05162  Measles
tup05163  Human cytomegalovirus infection
tup05164  Influenza A
tup05165  Human papillomavirus infection
tup05166  Human T-cell leukemia virus 1 infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05168  Herpes simplex virus 1 infection
tup05169  Epstein-Barr virus infection
tup05170  Human immunodeficiency virus 1 infection
tup05171  Coronavirus disease - COVID-19
tup05200  Pathways in cancer
tup05203  Viral carcinogenesis
tup05205  Proteoglycans in cancer
tup05206  MicroRNAs in cancer
tup05210  Colorectal cancer
tup05211  Renal cell carcinoma
tup05212  Pancreatic cancer
tup05213  Endometrial cancer
tup05214  Glioma
tup05215  Prostate cancer
tup05218  Melanoma
tup05220  Chronic myeloid leukemia
tup05221  Acute myeloid leukemia
tup05222  Small cell lung cancer
tup05223  Non-small cell lung cancer
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
tup05230  Central carbon metabolism in cancer
tup05231  Choline metabolism in cancer
tup05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tup05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102483329 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102483329 (PIK3CA)
   04014 Ras signaling pathway
    102483329 (PIK3CA)
   04015 Rap1 signaling pathway
    102483329 (PIK3CA)
   04370 VEGF signaling pathway
    102483329 (PIK3CA)
   04630 JAK-STAT signaling pathway
    102483329 (PIK3CA)
   04668 TNF signaling pathway
    102483329 (PIK3CA)
   04066 HIF-1 signaling pathway
    102483329 (PIK3CA)
   04068 FoxO signaling pathway
    102483329 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    102483329 (PIK3CA)
   04072 Phospholipase D signaling pathway
    102483329 (PIK3CA)
   04071 Sphingolipid signaling pathway
    102483329 (PIK3CA)
   04024 cAMP signaling pathway
    102483329 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    102483329 (PIK3CA)
   04152 AMPK signaling pathway
    102483329 (PIK3CA)
   04150 mTOR signaling pathway
    102483329 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102483329 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    102483329 (PIK3CA)
   04218 Cellular senescence
    102483329 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102483329 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    102483329 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102483329 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102483329 (PIK3CA)
   04613 Neutrophil extracellular trap formation
    102483329 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    102483329 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    102483329 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    102483329 (PIK3CA)
   04660 T cell receptor signaling pathway
    102483329 (PIK3CA)
   04662 B cell receptor signaling pathway
    102483329 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    102483329 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    102483329 (PIK3CA)
   04670 Leukocyte transendothelial migration
    102483329 (PIK3CA)
   04062 Chemokine signaling pathway
    102483329 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102483329 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    102483329 (PIK3CA)
   04929 GnRH secretion
    102483329 (PIK3CA)
   04915 Estrogen signaling pathway
    102483329 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    102483329 (PIK3CA)
   04917 Prolactin signaling pathway
    102483329 (PIK3CA)
   04926 Relaxin signaling pathway
    102483329 (PIK3CA)
   04935 Growth hormone synthesis, secretion and action
    102483329 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    102483329 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102483329 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102483329 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    102483329 (PIK3CA)
   04722 Neurotrophin signaling pathway
    102483329 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102483329 (PIK3CA)
  09158 Development and regeneration
   04360 Axon guidance
    102483329 (PIK3CA)
   04380 Osteoclast differentiation
    102483329 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    102483329 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    102483329 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102483329 (PIK3CA)
   05206 MicroRNAs in cancer
    102483329 (PIK3CA)
   05205 Proteoglycans in cancer
    102483329 (PIK3CA)
   05203 Viral carcinogenesis
    102483329 (PIK3CA)
   05230 Central carbon metabolism in cancer
    102483329 (PIK3CA)
   05231 Choline metabolism in cancer
    102483329 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102483329 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102483329 (PIK3CA)
   05212 Pancreatic cancer
    102483329 (PIK3CA)
   05225 Hepatocellular carcinoma
    102483329 (PIK3CA)
   05226 Gastric cancer
    102483329 (PIK3CA)
   05214 Glioma
    102483329 (PIK3CA)
   05221 Acute myeloid leukemia
    102483329 (PIK3CA)
   05220 Chronic myeloid leukemia
    102483329 (PIK3CA)
   05218 Melanoma
    102483329 (PIK3CA)
   05211 Renal cell carcinoma
    102483329 (PIK3CA)
   05215 Prostate cancer
    102483329 (PIK3CA)
   05213 Endometrial cancer
    102483329 (PIK3CA)
   05224 Breast cancer
    102483329 (PIK3CA)
   05222 Small cell lung cancer
    102483329 (PIK3CA)
   05223 Non-small cell lung cancer
    102483329 (PIK3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102483329 (PIK3CA)
   05017 Spinocerebellar ataxia
    102483329 (PIK3CA)
   05020 Prion disease
    102483329 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102483329 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102483329 (PIK3CA)
   04932 Non-alcoholic fatty liver disease
    102483329 (PIK3CA)
   04931 Insulin resistance
    102483329 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102483329 (PIK3CA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102483329 (PIK3CA)
   05135 Yersinia infection
    102483329 (PIK3CA)
   05100 Bacterial invasion of epithelial cells
    102483329 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102483329 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    102483329 (PIK3CA)
   05161 Hepatitis B
    102483329 (PIK3CA)
   05160 Hepatitis C
    102483329 (PIK3CA)
   05171 Coronavirus disease - COVID-19
    102483329 (PIK3CA)
   05164 Influenza A
    102483329 (PIK3CA)
   05162 Measles
    102483329 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    102483329 (PIK3CA)
   05163 Human cytomegalovirus infection
    102483329 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102483329 (PIK3CA)
   05169 Epstein-Barr virus infection
    102483329 (PIK3CA)
   05165 Human papillomavirus infection
    102483329 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102483329 (PIK3CA)
   05142 Chagas disease
    102483329 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102483329 (PIK3CA)
   01524 Platinum drug resistance
    102483329 (PIK3CA)
   01522 Endocrine resistance
    102483329 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tup04131]
    102483329 (PIK3CA)
Enzymes [BR:tup01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102483329 (PIK3CA)
Membrane trafficking [BR:tup04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102483329 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase DUF2321 Ribosomal_S15 DUF5314
Other DBs
NCBI-GeneID: 102483329
NCBI-ProteinID: XP_014448863
LinkDB
Position
Un
AA seq 580 aa
MSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLRAICTRDPLSEITEQEK
DFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIRPEQAMELLDCNYPD
PMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTNQRIGHFFF
WHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILKQEKKDETQ
KVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLWLNWENPDI
MSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQSQGLDLRMLPYGCLSIGDCVGLI
EVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRSCAGYCVAT
FILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGA
QECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLAL
DKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 1743 nt   +upstreamnt  +downstreamnt
atgtctgtgatcgaagagcatgccaactggtctgtgtcccgcgaggcaggatttagttac
tcccacgcaggactgagtaacagacttgctagagacaatgagttaagagaaaatgacaaa
gaacagctccgagccatctgtacccgagaccccctctctgaaattacggagcaagagaaa
gatttcctgtggagccacagacactattgtgtaactatccctgaaattctacccaaattg
cttctgtctgttaaatggaactctagagatgaagtagcccagatgtactgcctggtcaag
gactggcctcccatcaggccggagcaggcgatggagcttctggactgtaactacccagac
cccatggttcgaggctttgctgttcgatgcttggaaaaatatttaacagatgacaaactg
tctcagtacctgattcagctggtgcaggttctaaaatatgaacaatatttggataacttg
cttgtgagatttttactcaaaaaagcattgactaatcaaaggattgggcactttttcttt
tggcatttaaaatccgagatgcacaacaaaacggtgagccagaggttcggcctgctcttg
gagtcctattgccgagcgtgtgggatgtacctgaagcacctgaacaggcaggtcgaggcc
atggagaagctcatcaacctgacggacattctgaaacaggagaagaaggacgagacgcag
aaggtacagatgaagtttttggtagaacagatgaggcggccagacttcatggatgccctc
cagggctttctgtctcctctcaaccccgctcatcagctgggaaacctcaggcttgaagag
tgtcgaatcatgtcctcggcaaaaaggcctctgtggctgaactgggagaacccagacatc
atgtccgagttactgtttcagaacaacgagatcatctttaaaaatggggatgatttacgg
caagatatgctgacacttcagattatccgcatcatggaaaacatctggcaaagtcaaggt
cttgatcttcgaatgttaccctacggctgtctgtctatcggtgactgtgtggggctcatc
gaggtggtgagaaactctcacaccatcatgcagatccagtgcaaaggcggcctgaagggg
gcgctgcagttcaacagccacacgctgcaccagtggctcaaagacaagaacaaaggggag
atatacgatgccgccattgacctgttcacacgctcgtgcgcggggtactgcgtcgccacc
ttcatcctggggattggggaccgccacaacagcaacatcatggtgaaggacgacgggcag
ttgtttcatatagattttggacactttttggatcacaagaagaaaaagtttggttataaa
cgagaacgtgtgccatttgtattgacacaagatttcttaatagtgatcagcaaaggagcc
caagaatgcacaaaaacaagagaatttgagaggttccaggagatgtgttacaaggcttac
cttgccatccggcagcacgccaacctcttcatcaaccttttctccatgatgctcggctct
gggatgccggaactgcagtcttttgatgacattgcatacattcgaaagaccctggccttg
gataaaactgagcaggaggctctggagtacttcatgaagcagatgaatgatgcacaccac
ggcggctggacgacaaagatggactggatcttccacaccattaagcagcacgcgttgaac
tga

KEGG   Tupaia chinensis (Chinese tree shrew): 102484444
Entry
102484444         CDS       T02978                                 

Gene name
PIK3R3
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 3
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01521  EGFR tyrosine kinase inhibitor resistance
tup01522  Endocrine resistance
tup01524  Platinum drug resistance
tup04012  ErbB signaling pathway
tup04014  Ras signaling pathway
tup04015  Rap1 signaling pathway
tup04024  cAMP signaling pathway
tup04062  Chemokine signaling pathway
tup04066  HIF-1 signaling pathway
tup04068  FoxO signaling pathway
tup04070  Phosphatidylinositol signaling system
tup04071  Sphingolipid signaling pathway
tup04072  Phospholipase D signaling pathway
tup04140  Autophagy - animal
tup04150  mTOR signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04152  AMPK signaling pathway
tup04210  Apoptosis
tup04211  Longevity regulating pathway
tup04213  Longevity regulating pathway - multiple species
tup04218  Cellular senescence
tup04360  Axon guidance
tup04370  VEGF signaling pathway
tup04380  Osteoclast differentiation
tup04510  Focal adhesion
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04611  Platelet activation
tup04613  Neutrophil extracellular trap formation
tup04620  Toll-like receptor signaling pathway
tup04625  C-type lectin receptor signaling pathway
tup04630  JAK-STAT signaling pathway
tup04650  Natural killer cell mediated cytotoxicity
tup04660  T cell receptor signaling pathway
tup04662  B cell receptor signaling pathway
tup04664  Fc epsilon RI signaling pathway
tup04666  Fc gamma R-mediated phagocytosis
tup04668  TNF signaling pathway
tup04670  Leukocyte transendothelial migration
tup04722  Neurotrophin signaling pathway
tup04725  Cholinergic synapse
tup04750  Inflammatory mediator regulation of TRP channels
tup04810  Regulation of actin cytoskeleton
tup04910  Insulin signaling pathway
tup04914  Progesterone-mediated oocyte maturation
tup04915  Estrogen signaling pathway
tup04917  Prolactin signaling pathway
tup04919  Thyroid hormone signaling pathway
tup04923  Regulation of lipolysis in adipocytes
tup04926  Relaxin signaling pathway
tup04929  GnRH secretion
tup04930  Type II diabetes mellitus
tup04931  Insulin resistance
tup04932  Non-alcoholic fatty liver disease
tup04933  AGE-RAGE signaling pathway in diabetic complications
tup04935  Growth hormone synthesis, secretion and action
tup04960  Aldosterone-regulated sodium reabsorption
tup04973  Carbohydrate digestion and absorption
tup05010  Alzheimer disease
tup05017  Spinocerebellar ataxia
tup05020  Prion disease
tup05100  Bacterial invasion of epithelial cells
tup05135  Yersinia infection
tup05142  Chagas disease
tup05146  Amoebiasis
tup05160  Hepatitis C
tup05161  Hepatitis B
tup05162  Measles
tup05163  Human cytomegalovirus infection
tup05164  Influenza A
tup05165  Human papillomavirus infection
tup05166  Human T-cell leukemia virus 1 infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05168  Herpes simplex virus 1 infection
tup05169  Epstein-Barr virus infection
tup05170  Human immunodeficiency virus 1 infection
tup05171  Coronavirus disease - COVID-19
tup05200  Pathways in cancer
tup05203  Viral carcinogenesis
tup05205  Proteoglycans in cancer
tup05206  MicroRNAs in cancer
tup05210  Colorectal cancer
tup05211  Renal cell carcinoma
tup05212  Pancreatic cancer
tup05213  Endometrial cancer
tup05214  Glioma
tup05215  Prostate cancer
tup05218  Melanoma
tup05220  Chronic myeloid leukemia
tup05221  Acute myeloid leukemia
tup05222  Small cell lung cancer
tup05223  Non-small cell lung cancer
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
tup05230  Central carbon metabolism in cancer
tup05231  Choline metabolism in cancer
tup05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tup05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102484444 (PIK3R3)
   04014 Ras signaling pathway
    102484444 (PIK3R3)
   04015 Rap1 signaling pathway
    102484444 (PIK3R3)
   04370 VEGF signaling pathway
    102484444 (PIK3R3)
   04630 JAK-STAT signaling pathway
    102484444 (PIK3R3)
   04668 TNF signaling pathway
    102484444 (PIK3R3)
   04066 HIF-1 signaling pathway
    102484444 (PIK3R3)
   04068 FoxO signaling pathway
    102484444 (PIK3R3)
   04070 Phosphatidylinositol signaling system
    102484444 (PIK3R3)
   04072 Phospholipase D signaling pathway
    102484444 (PIK3R3)
   04071 Sphingolipid signaling pathway
    102484444 (PIK3R3)
   04024 cAMP signaling pathway
    102484444 (PIK3R3)
   04151 PI3K-Akt signaling pathway
    102484444 (PIK3R3)
   04152 AMPK signaling pathway
    102484444 (PIK3R3)
   04150 mTOR signaling pathway
    102484444 (PIK3R3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102484444 (PIK3R3)
  09143 Cell growth and death
   04210 Apoptosis
    102484444 (PIK3R3)
   04218 Cellular senescence
    102484444 (PIK3R3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102484444 (PIK3R3)
   04550 Signaling pathways regulating pluripotency of stem cells
    102484444 (PIK3R3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102484444 (PIK3R3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102484444 (PIK3R3)
   04613 Neutrophil extracellular trap formation
    102484444 (PIK3R3)
   04620 Toll-like receptor signaling pathway
    102484444 (PIK3R3)
   04625 C-type lectin receptor signaling pathway
    102484444 (PIK3R3)
   04650 Natural killer cell mediated cytotoxicity
    102484444 (PIK3R3)
   04660 T cell receptor signaling pathway
    102484444 (PIK3R3)
   04662 B cell receptor signaling pathway
    102484444 (PIK3R3)
   04664 Fc epsilon RI signaling pathway
    102484444 (PIK3R3)
   04666 Fc gamma R-mediated phagocytosis
    102484444 (PIK3R3)
   04670 Leukocyte transendothelial migration
    102484444 (PIK3R3)
   04062 Chemokine signaling pathway
    102484444 (PIK3R3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102484444 (PIK3R3)
   04923 Regulation of lipolysis in adipocytes
    102484444 (PIK3R3)
   04929 GnRH secretion
    102484444 (PIK3R3)
   04915 Estrogen signaling pathway
    102484444 (PIK3R3)
   04914 Progesterone-mediated oocyte maturation
    102484444 (PIK3R3)
   04917 Prolactin signaling pathway
    102484444 (PIK3R3)
   04926 Relaxin signaling pathway
    102484444 (PIK3R3)
   04935 Growth hormone synthesis, secretion and action
    102484444 (PIK3R3)
   04919 Thyroid hormone signaling pathway
    102484444 (PIK3R3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102484444 (PIK3R3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102484444 (PIK3R3)
  09156 Nervous system
   04725 Cholinergic synapse
    102484444 (PIK3R3)
   04722 Neurotrophin signaling pathway
    102484444 (PIK3R3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102484444 (PIK3R3)
  09158 Development and regeneration
   04360 Axon guidance
    102484444 (PIK3R3)
   04380 Osteoclast differentiation
    102484444 (PIK3R3)
  09149 Aging
   04211 Longevity regulating pathway
    102484444 (PIK3R3)
   04213 Longevity regulating pathway - multiple species
    102484444 (PIK3R3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102484444 (PIK3R3)
   05206 MicroRNAs in cancer
    102484444 (PIK3R3)
   05205 Proteoglycans in cancer
    102484444 (PIK3R3)
   05203 Viral carcinogenesis
    102484444 (PIK3R3)
   05230 Central carbon metabolism in cancer
    102484444 (PIK3R3)
   05231 Choline metabolism in cancer
    102484444 (PIK3R3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102484444 (PIK3R3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102484444 (PIK3R3)
   05212 Pancreatic cancer
    102484444 (PIK3R3)
   05225 Hepatocellular carcinoma
    102484444 (PIK3R3)
   05226 Gastric cancer
    102484444 (PIK3R3)
   05214 Glioma
    102484444 (PIK3R3)
   05221 Acute myeloid leukemia
    102484444 (PIK3R3)
   05220 Chronic myeloid leukemia
    102484444 (PIK3R3)
   05218 Melanoma
    102484444 (PIK3R3)
   05211 Renal cell carcinoma
    102484444 (PIK3R3)
   05215 Prostate cancer
    102484444 (PIK3R3)
   05213 Endometrial cancer
    102484444 (PIK3R3)
   05224 Breast cancer
    102484444 (PIK3R3)
   05222 Small cell lung cancer
    102484444 (PIK3R3)
   05223 Non-small cell lung cancer
    102484444 (PIK3R3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102484444 (PIK3R3)
   05017 Spinocerebellar ataxia
    102484444 (PIK3R3)
   05020 Prion disease
    102484444 (PIK3R3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102484444 (PIK3R3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102484444 (PIK3R3)
   04932 Non-alcoholic fatty liver disease
    102484444 (PIK3R3)
   04931 Insulin resistance
    102484444 (PIK3R3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102484444 (PIK3R3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102484444 (PIK3R3)
   05100 Bacterial invasion of epithelial cells
    102484444 (PIK3R3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102484444 (PIK3R3)
   05170 Human immunodeficiency virus 1 infection
    102484444 (PIK3R3)
   05161 Hepatitis B
    102484444 (PIK3R3)
   05160 Hepatitis C
    102484444 (PIK3R3)
   05171 Coronavirus disease - COVID-19
    102484444 (PIK3R3)
   05164 Influenza A
    102484444 (PIK3R3)
   05162 Measles
    102484444 (PIK3R3)
   05168 Herpes simplex virus 1 infection
    102484444 (PIK3R3)
   05163 Human cytomegalovirus infection
    102484444 (PIK3R3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102484444 (PIK3R3)
   05169 Epstein-Barr virus infection
    102484444 (PIK3R3)
   05165 Human papillomavirus infection
    102484444 (PIK3R3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102484444 (PIK3R3)
   05142 Chagas disease
    102484444 (PIK3R3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102484444 (PIK3R3)
   01524 Platinum drug resistance
    102484444 (PIK3R3)
   01522 Endocrine resistance
    102484444 (PIK3R3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tup04131]
    102484444 (PIK3R3)
Membrane trafficking [BR:tup04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102484444 (PIK3R3)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Transcrip_act Fez1 Exonuc_VII_L DUF5638 PI_PP_I
Other DBs
NCBI-GeneID: 102484444
NCBI-ProteinID: XP_006164287
LinkDB
Position
Un
AA seq 461 aa
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAVSNGMKENSVSL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSDPLTFTSVVELINHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKK
LQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEY
IERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKKQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHKGVRQKRLNAWLGIKNEDADETYFINEEDENLPHYDEKTWFV
EDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYNTARGYGFAEPYN
LYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgtacaatacggtgtggagtatggatcgcgatgacgcagactggagggaggtgatgatg
ccctattcgacagaactgatattttatattgaaatggatcctccagctcttccaccaaag
ccacctaagccaatgacttcagcagtttcaaatggaatgaaggagaattctgtttctctt
caggatgcagaatggtactggggagatatttcaagggaggaggtaaatgacaaattacga
gacatgccagatggtaccttcttggttcgagatgcctcaacaaagatgcagggagattat
accctgactttgcggaagggaggcaataataagttgataaagatctatcatcgggatggt
aaatatggcttttctgatcctctgacatttacttctgtggtggagcttattaaccactat
catcatgaatctcttgctcagtacaatcccaaactggatgtgaagctgatgtacccagtg
tccagataccagcaggatcaattggttaaagaagataacattgatgcagtaggtaaaaaa
ctgcaagaataccattctcagtatcaggaaaagagtaaagagtatgataggctgtatgaa
gaatataccagaacatcccaggaaatacagatgaagaggactgcaattgaagcttttaat
gaaacaattaaaatatttgaggaacagtgtcacacacaagaacaacatagcaaagagtat
atagaacggtttcgcagagaagggaatgaaaaggagattgaacggattatgatgaattat
gataaattgaaatcacgtctgggtgagattcatgatagcaaaatgcgtctagagcaagat
ttgaagaaacaggctttggacaaccgagaaatagataaaaaaatgaatagcatcaaacct
gacctgatccagctgcgcaagatccgagatcagcaccttgtatggctcaatcacaaagga
gtgagacagaaacgcctgaatgcctggctggggatcaagaatgaggatgctgatgagacc
tactttatcaatgaggaagatgaaaacctgccccattatgatgagaaaacctggtttgtc
gaggatatcaatcgagtacaagcagaagacttactctatgggaaacctgatggtgcattt
ttaattcgtgagagtagcaagaaaggatgctacgcttgctctgtcgttgccgacggggaa
gtgaagcactgtgtgatctacaacactgcccggggctacggctttgcagagccctacaac
ctgtacagctcgctgaaggagctggtgctccactaccagcagacatccctggttcagcac
aacgactccctcaacgtcaggcttgcctaccctgtccacgcacagatgccgtcgctctgc
agataa

KEGG   Tupaia chinensis (Chinese tree shrew): 102484500
Entry
102484500         CDS       T02978                                 

Gene name
PIK3R1
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01521  EGFR tyrosine kinase inhibitor resistance
tup01522  Endocrine resistance
tup01524  Platinum drug resistance
tup04012  ErbB signaling pathway
tup04014  Ras signaling pathway
tup04015  Rap1 signaling pathway
tup04024  cAMP signaling pathway
tup04062  Chemokine signaling pathway
tup04066  HIF-1 signaling pathway
tup04068  FoxO signaling pathway
tup04070  Phosphatidylinositol signaling system
tup04071  Sphingolipid signaling pathway
tup04072  Phospholipase D signaling pathway
tup04140  Autophagy - animal
tup04150  mTOR signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04152  AMPK signaling pathway
tup04210  Apoptosis
tup04211  Longevity regulating pathway
tup04213  Longevity regulating pathway - multiple species
tup04218  Cellular senescence
tup04360  Axon guidance
tup04370  VEGF signaling pathway
tup04380  Osteoclast differentiation
tup04510  Focal adhesion
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04611  Platelet activation
tup04613  Neutrophil extracellular trap formation
tup04620  Toll-like receptor signaling pathway
tup04625  C-type lectin receptor signaling pathway
tup04630  JAK-STAT signaling pathway
tup04650  Natural killer cell mediated cytotoxicity
tup04660  T cell receptor signaling pathway
tup04662  B cell receptor signaling pathway
tup04664  Fc epsilon RI signaling pathway
tup04666  Fc gamma R-mediated phagocytosis
tup04668  TNF signaling pathway
tup04670  Leukocyte transendothelial migration
tup04722  Neurotrophin signaling pathway
tup04725  Cholinergic synapse
tup04750  Inflammatory mediator regulation of TRP channels
tup04810  Regulation of actin cytoskeleton
tup04910  Insulin signaling pathway
tup04914  Progesterone-mediated oocyte maturation
tup04915  Estrogen signaling pathway
tup04917  Prolactin signaling pathway
tup04919  Thyroid hormone signaling pathway
tup04923  Regulation of lipolysis in adipocytes
tup04926  Relaxin signaling pathway
tup04929  GnRH secretion
tup04930  Type II diabetes mellitus
tup04931  Insulin resistance
tup04932  Non-alcoholic fatty liver disease
tup04933  AGE-RAGE signaling pathway in diabetic complications
tup04935  Growth hormone synthesis, secretion and action
tup04960  Aldosterone-regulated sodium reabsorption
tup04973  Carbohydrate digestion and absorption
tup05010  Alzheimer disease
tup05017  Spinocerebellar ataxia
tup05020  Prion disease
tup05100  Bacterial invasion of epithelial cells
tup05135  Yersinia infection
tup05142  Chagas disease
tup05146  Amoebiasis
tup05160  Hepatitis C
tup05161  Hepatitis B
tup05162  Measles
tup05163  Human cytomegalovirus infection
tup05164  Influenza A
tup05165  Human papillomavirus infection
tup05166  Human T-cell leukemia virus 1 infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05168  Herpes simplex virus 1 infection
tup05169  Epstein-Barr virus infection
tup05170  Human immunodeficiency virus 1 infection
tup05171  Coronavirus disease - COVID-19
tup05200  Pathways in cancer
tup05203  Viral carcinogenesis
tup05205  Proteoglycans in cancer
tup05206  MicroRNAs in cancer
tup05210  Colorectal cancer
tup05211  Renal cell carcinoma
tup05212  Pancreatic cancer
tup05213  Endometrial cancer
tup05214  Glioma
tup05215  Prostate cancer
tup05218  Melanoma
tup05220  Chronic myeloid leukemia
tup05221  Acute myeloid leukemia
tup05222  Small cell lung cancer
tup05223  Non-small cell lung cancer
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
tup05230  Central carbon metabolism in cancer
tup05231  Choline metabolism in cancer
tup05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tup05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102484500 (PIK3R1)
   04014 Ras signaling pathway
    102484500 (PIK3R1)
   04015 Rap1 signaling pathway
    102484500 (PIK3R1)
   04370 VEGF signaling pathway
    102484500 (PIK3R1)
   04630 JAK-STAT signaling pathway
    102484500 (PIK3R1)
   04668 TNF signaling pathway
    102484500 (PIK3R1)
   04066 HIF-1 signaling pathway
    102484500 (PIK3R1)
   04068 FoxO signaling pathway
    102484500 (PIK3R1)
   04070 Phosphatidylinositol signaling system
    102484500 (PIK3R1)
   04072 Phospholipase D signaling pathway
    102484500 (PIK3R1)
   04071 Sphingolipid signaling pathway
    102484500 (PIK3R1)
   04024 cAMP signaling pathway
    102484500 (PIK3R1)
   04151 PI3K-Akt signaling pathway
    102484500 (PIK3R1)
   04152 AMPK signaling pathway
    102484500 (PIK3R1)
   04150 mTOR signaling pathway
    102484500 (PIK3R1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102484500 (PIK3R1)
  09143 Cell growth and death
   04210 Apoptosis
    102484500 (PIK3R1)
   04218 Cellular senescence
    102484500 (PIK3R1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102484500 (PIK3R1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102484500 (PIK3R1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102484500 (PIK3R1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102484500 (PIK3R1)
   04613 Neutrophil extracellular trap formation
    102484500 (PIK3R1)
   04620 Toll-like receptor signaling pathway
    102484500 (PIK3R1)
   04625 C-type lectin receptor signaling pathway
    102484500 (PIK3R1)
   04650 Natural killer cell mediated cytotoxicity
    102484500 (PIK3R1)
   04660 T cell receptor signaling pathway
    102484500 (PIK3R1)
   04662 B cell receptor signaling pathway
    102484500 (PIK3R1)
   04664 Fc epsilon RI signaling pathway
    102484500 (PIK3R1)
   04666 Fc gamma R-mediated phagocytosis
    102484500 (PIK3R1)
   04670 Leukocyte transendothelial migration
    102484500 (PIK3R1)
   04062 Chemokine signaling pathway
    102484500 (PIK3R1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102484500 (PIK3R1)
   04923 Regulation of lipolysis in adipocytes
    102484500 (PIK3R1)
   04929 GnRH secretion
    102484500 (PIK3R1)
   04915 Estrogen signaling pathway
    102484500 (PIK3R1)
   04914 Progesterone-mediated oocyte maturation
    102484500 (PIK3R1)
   04917 Prolactin signaling pathway
    102484500 (PIK3R1)
   04926 Relaxin signaling pathway
    102484500 (PIK3R1)
   04935 Growth hormone synthesis, secretion and action
    102484500 (PIK3R1)
   04919 Thyroid hormone signaling pathway
    102484500 (PIK3R1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102484500 (PIK3R1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102484500 (PIK3R1)
  09156 Nervous system
   04725 Cholinergic synapse
    102484500 (PIK3R1)
   04722 Neurotrophin signaling pathway
    102484500 (PIK3R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102484500 (PIK3R1)
  09158 Development and regeneration
   04360 Axon guidance
    102484500 (PIK3R1)
   04380 Osteoclast differentiation
    102484500 (PIK3R1)
  09149 Aging
   04211 Longevity regulating pathway
    102484500 (PIK3R1)
   04213 Longevity regulating pathway - multiple species
    102484500 (PIK3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102484500 (PIK3R1)
   05206 MicroRNAs in cancer
    102484500 (PIK3R1)
   05205 Proteoglycans in cancer
    102484500 (PIK3R1)
   05203 Viral carcinogenesis
    102484500 (PIK3R1)
   05230 Central carbon metabolism in cancer
    102484500 (PIK3R1)
   05231 Choline metabolism in cancer
    102484500 (PIK3R1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102484500 (PIK3R1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102484500 (PIK3R1)
   05212 Pancreatic cancer
    102484500 (PIK3R1)
   05225 Hepatocellular carcinoma
    102484500 (PIK3R1)
   05226 Gastric cancer
    102484500 (PIK3R1)
   05214 Glioma
    102484500 (PIK3R1)
   05221 Acute myeloid leukemia
    102484500 (PIK3R1)
   05220 Chronic myeloid leukemia
    102484500 (PIK3R1)
   05218 Melanoma
    102484500 (PIK3R1)
   05211 Renal cell carcinoma
    102484500 (PIK3R1)
   05215 Prostate cancer
    102484500 (PIK3R1)
   05213 Endometrial cancer
    102484500 (PIK3R1)
   05224 Breast cancer
    102484500 (PIK3R1)
   05222 Small cell lung cancer
    102484500 (PIK3R1)
   05223 Non-small cell lung cancer
    102484500 (PIK3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102484500 (PIK3R1)
   05017 Spinocerebellar ataxia
    102484500 (PIK3R1)
   05020 Prion disease
    102484500 (PIK3R1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102484500 (PIK3R1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102484500 (PIK3R1)
   04932 Non-alcoholic fatty liver disease
    102484500 (PIK3R1)
   04931 Insulin resistance
    102484500 (PIK3R1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102484500 (PIK3R1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102484500 (PIK3R1)
   05100 Bacterial invasion of epithelial cells
    102484500 (PIK3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102484500 (PIK3R1)
   05170 Human immunodeficiency virus 1 infection
    102484500 (PIK3R1)
   05161 Hepatitis B
    102484500 (PIK3R1)
   05160 Hepatitis C
    102484500 (PIK3R1)
   05171 Coronavirus disease - COVID-19
    102484500 (PIK3R1)
   05164 Influenza A
    102484500 (PIK3R1)
   05162 Measles
    102484500 (PIK3R1)
   05168 Herpes simplex virus 1 infection
    102484500 (PIK3R1)
   05163 Human cytomegalovirus infection
    102484500 (PIK3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102484500 (PIK3R1)
   05169 Epstein-Barr virus infection
    102484500 (PIK3R1)
   05165 Human papillomavirus infection
    102484500 (PIK3R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102484500 (PIK3R1)
   05142 Chagas disease
    102484500 (PIK3R1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102484500 (PIK3R1)
   01524 Platinum drug resistance
    102484500 (PIK3R1)
   01522 Endocrine resistance
    102484500 (PIK3R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tup04131]
    102484500 (PIK3R1)
Membrane trafficking [BR:tup04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102484500 (PIK3R1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 SH3_2 Lant_dehydr_C PI_PP_I Laminin_I
Other DBs
NCBI-GeneID: 102484500
NCBI-ProteinID: XP_006169589
LinkDB
Position
Un
AA seq 725 aa
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVAHGFSDGQEARPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKTETDSEQQALTLPDLAE
QFAPPDIAPPLLIKLVEAIEKKGLECSTLYRTQSSSTPAELRQLLDCDTASVDLEMIDVH
VLADAFKRYLLDLPNPVIPVAVYSEMISLAQEVQSSEEYTQLLKKLIRSPHIPHQYWLTL
QYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFPATSSDSTEHFTKVVEILIATEWSE
RQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDNIEAVGFKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQM
KRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNYDKLKSRISEII
DSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLG
NENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYAC
SVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVY
AQQRR
NT seq 2178 nt   +upstreamnt  +downstreamnt
atgagtgccgagggctaccagtaccgagcgctgtacgactataagaaggaacgagaggaa
gatatcgacttgcacttgggtgacattttgactgtgaataaaggatctttagtagcacat
ggattcagtgatggacaagaagccagacctgaagaaatcggctggttaaatggctataat
gaaaccacgggggagaggggagactttccgggaacttatgtagaatatattggaaggaaa
aaaatctcacccccgacaccaaagccccggccacctcgaccccttcctgttgcaccaggt
tcttctaaaactgaaacagacagtgaacaacaagctttgactcttccagatcttgcagag
cagttcgcccctcctgacattgccccacctcttctgatcaagcttgtggaagccattgaa
aagaaaggtctggaatgttcaactctatacagaacacagagctccagcaccccagcagaa
ttacgacagcttcttgattgtgatacggcttctgtggacttggaaatgatcgatgtgcac
gttttagcagatgctttcaaacgctatctcctggacttaccaaatcctgtcattccagta
gccgtttacagtgaaatgatttctttagcccaagaagtacaaagctccgaagaatatacc
cagctattgaagaagctcattagatcgcctcacatacctcatcagtattggcttacactt
cagtatctgctgaaacatttcttcaagctctctcaaacctccagcaaaaatctcttgaat
gcaagagtgctctcagaaattttcagccctatgcttttcagattcccagcaaccagctct
gatagtaccgaacacttcacaaaagttgtagaaattttaattgcaactgaatggagtgag
cgacagcctgcaccagcactgccacctaagccaccaaaacccactactgtagccaacaac
ggtatgaataacaatatgtccttacaagatgctgaatggtactggggtgatatctcaagg
gaagaagtaaatgaaaaacttcgagatacagcagatgggacctttctggtacgagatgca
tctactaaaatgcatggtgattatactcttacactaaggaaaggaggaaataacaaatta
atcaaaatatttcaccgagatgggaaatatggcttctctgacccattaaccttcaattct
gtggttgaattaataaaccactaccggaatgaatctctagctcagtataatcccaaactg
gatgtgaaattactttatccagtatccaaataccaacaggatcaggttgtcaaagaagat
aatattgaagctgtaggttttaaaaagttacatgaatataacactcagtttcaagaaaag
agtagagaatatgatagattgtatgaagaatatactcgtacttcccaggaaattcaaatg
aaaagaacagctattgaagcatttaatgaaaccataaaaatatttgaagaacagtgccaa
acccaggagaggtacagcaaagagtatatagagaagtttaaacgtgaaggcaatgaaaaa
gaaatacaaaggattatgcataattatgataagttaaagtctcgaatcagtgagattatt
gacagtagaagaagattggaggaagacctcaagaagcaggcagctgagtaccgagagatc
gacaaacgcatgaacagcattaaaccagacctcattcagctgagaaagacgagagaccaa
tacttgatgtggttgacccaaaaaggtgttcggcagaagaagttgaacgaatggttgggc
aatgaaaacactgaggaccaatattccctggtggaagacgatgaggatttgccccaccac
gatgagaagacgtggaatgtcggaagcagcaaccgaaataaagctgaaaacctgttgcgg
gggaagcgagatggcacatttctagtccgggagagcagtaaacagggctgctatgcctgc
tctgtagtggtggacggtgaagtaaagcactgtgtcatcaacaagacggcgaccggctat
ggctttgctgagccctataacttgtacagctctctgaaagaactggtgctacattaccaa
cacacctccctcgtgcagcacaatgactccctcaacgtcacactagcctacccggtatat
gcacagcagaggcgatga

KEGG   Tupaia chinensis (Chinese tree shrew): 102500530
Entry
102500530         CDS       T02978                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00562  Inositol phosphate metabolism
tup01100  Metabolic pathways
tup01521  EGFR tyrosine kinase inhibitor resistance
tup01522  Endocrine resistance
tup01524  Platinum drug resistance
tup04012  ErbB signaling pathway
tup04014  Ras signaling pathway
tup04015  Rap1 signaling pathway
tup04024  cAMP signaling pathway
tup04062  Chemokine signaling pathway
tup04066  HIF-1 signaling pathway
tup04068  FoxO signaling pathway
tup04070  Phosphatidylinositol signaling system
tup04071  Sphingolipid signaling pathway
tup04072  Phospholipase D signaling pathway
tup04140  Autophagy - animal
tup04150  mTOR signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04152  AMPK signaling pathway
tup04210  Apoptosis
tup04211  Longevity regulating pathway
tup04213  Longevity regulating pathway - multiple species
tup04218  Cellular senescence
tup04360  Axon guidance
tup04370  VEGF signaling pathway
tup04380  Osteoclast differentiation
tup04510  Focal adhesion
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04611  Platelet activation
tup04613  Neutrophil extracellular trap formation
tup04620  Toll-like receptor signaling pathway
tup04625  C-type lectin receptor signaling pathway
tup04630  JAK-STAT signaling pathway
tup04650  Natural killer cell mediated cytotoxicity
tup04660  T cell receptor signaling pathway
tup04662  B cell receptor signaling pathway
tup04664  Fc epsilon RI signaling pathway
tup04666  Fc gamma R-mediated phagocytosis
tup04668  TNF signaling pathway
tup04670  Leukocyte transendothelial migration
tup04722  Neurotrophin signaling pathway
tup04725  Cholinergic synapse
tup04750  Inflammatory mediator regulation of TRP channels
tup04810  Regulation of actin cytoskeleton
tup04910  Insulin signaling pathway
tup04914  Progesterone-mediated oocyte maturation
tup04915  Estrogen signaling pathway
tup04917  Prolactin signaling pathway
tup04919  Thyroid hormone signaling pathway
tup04923  Regulation of lipolysis in adipocytes
tup04926  Relaxin signaling pathway
tup04929  GnRH secretion
tup04930  Type II diabetes mellitus
tup04931  Insulin resistance
tup04932  Non-alcoholic fatty liver disease
tup04933  AGE-RAGE signaling pathway in diabetic complications
tup04935  Growth hormone synthesis, secretion and action
tup04960  Aldosterone-regulated sodium reabsorption
tup04973  Carbohydrate digestion and absorption
tup05010  Alzheimer disease
tup05017  Spinocerebellar ataxia
tup05020  Prion disease
tup05100  Bacterial invasion of epithelial cells
tup05132  Salmonella infection
tup05135  Yersinia infection
tup05142  Chagas disease
tup05146  Amoebiasis
tup05160  Hepatitis C
tup05161  Hepatitis B
tup05162  Measles
tup05163  Human cytomegalovirus infection
tup05164  Influenza A
tup05165  Human papillomavirus infection
tup05166  Human T-cell leukemia virus 1 infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05168  Herpes simplex virus 1 infection
tup05169  Epstein-Barr virus infection
tup05170  Human immunodeficiency virus 1 infection
tup05171  Coronavirus disease - COVID-19
tup05200  Pathways in cancer
tup05203  Viral carcinogenesis
tup05205  Proteoglycans in cancer
tup05206  MicroRNAs in cancer
tup05210  Colorectal cancer
tup05211  Renal cell carcinoma
tup05212  Pancreatic cancer
tup05213  Endometrial cancer
tup05214  Glioma
tup05215  Prostate cancer
tup05218  Melanoma
tup05220  Chronic myeloid leukemia
tup05221  Acute myeloid leukemia
tup05222  Small cell lung cancer
tup05223  Non-small cell lung cancer
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
tup05230  Central carbon metabolism in cancer
tup05231  Choline metabolism in cancer
tup05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tup05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102500530 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102500530 (PIK3CD)
   04014 Ras signaling pathway
    102500530 (PIK3CD)
   04015 Rap1 signaling pathway
    102500530 (PIK3CD)
   04370 VEGF signaling pathway
    102500530 (PIK3CD)
   04630 JAK-STAT signaling pathway
    102500530 (PIK3CD)
   04668 TNF signaling pathway
    102500530 (PIK3CD)
   04066 HIF-1 signaling pathway
    102500530 (PIK3CD)
   04068 FoxO signaling pathway
    102500530 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    102500530 (PIK3CD)
   04072 Phospholipase D signaling pathway
    102500530 (PIK3CD)
   04071 Sphingolipid signaling pathway
    102500530 (PIK3CD)
   04024 cAMP signaling pathway
    102500530 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    102500530 (PIK3CD)
   04152 AMPK signaling pathway
    102500530 (PIK3CD)
   04150 mTOR signaling pathway
    102500530 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102500530 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    102500530 (PIK3CD)
   04218 Cellular senescence
    102500530 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102500530 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    102500530 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102500530 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102500530 (PIK3CD)
   04613 Neutrophil extracellular trap formation
    102500530 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    102500530 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    102500530 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    102500530 (PIK3CD)
   04660 T cell receptor signaling pathway
    102500530 (PIK3CD)
   04662 B cell receptor signaling pathway
    102500530 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    102500530 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    102500530 (PIK3CD)
   04670 Leukocyte transendothelial migration
    102500530 (PIK3CD)
   04062 Chemokine signaling pathway
    102500530 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102500530 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    102500530 (PIK3CD)
   04929 GnRH secretion
    102500530 (PIK3CD)
   04915 Estrogen signaling pathway
    102500530 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    102500530 (PIK3CD)
   04917 Prolactin signaling pathway
    102500530 (PIK3CD)
   04926 Relaxin signaling pathway
    102500530 (PIK3CD)
   04935 Growth hormone synthesis, secretion and action
    102500530 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    102500530 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102500530 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102500530 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    102500530 (PIK3CD)
   04722 Neurotrophin signaling pathway
    102500530 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102500530 (PIK3CD)
  09158 Development and regeneration
   04360 Axon guidance
    102500530 (PIK3CD)
   04380 Osteoclast differentiation
    102500530 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    102500530 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    102500530 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102500530 (PIK3CD)
   05206 MicroRNAs in cancer
    102500530 (PIK3CD)
   05205 Proteoglycans in cancer
    102500530 (PIK3CD)
   05203 Viral carcinogenesis
    102500530 (PIK3CD)
   05230 Central carbon metabolism in cancer
    102500530 (PIK3CD)
   05231 Choline metabolism in cancer
    102500530 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102500530 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102500530 (PIK3CD)
   05212 Pancreatic cancer
    102500530 (PIK3CD)
   05225 Hepatocellular carcinoma
    102500530 (PIK3CD)
   05226 Gastric cancer
    102500530 (PIK3CD)
   05214 Glioma
    102500530 (PIK3CD)
   05221 Acute myeloid leukemia
    102500530 (PIK3CD)
   05220 Chronic myeloid leukemia
    102500530 (PIK3CD)
   05218 Melanoma
    102500530 (PIK3CD)
   05211 Renal cell carcinoma
    102500530 (PIK3CD)
   05215 Prostate cancer
    102500530 (PIK3CD)
   05213 Endometrial cancer
    102500530 (PIK3CD)
   05224 Breast cancer
    102500530 (PIK3CD)
   05222 Small cell lung cancer
    102500530 (PIK3CD)
   05223 Non-small cell lung cancer
    102500530 (PIK3CD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102500530 (PIK3CD)
   05017 Spinocerebellar ataxia
    102500530 (PIK3CD)
   05020 Prion disease
    102500530 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102500530 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102500530 (PIK3CD)
   04932 Non-alcoholic fatty liver disease
    102500530 (PIK3CD)
   04931 Insulin resistance
    102500530 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102500530 (PIK3CD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102500530 (PIK3CD)
   05135 Yersinia infection
    102500530 (PIK3CD)
   05100 Bacterial invasion of epithelial cells
    102500530 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102500530 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    102500530 (PIK3CD)
   05161 Hepatitis B
    102500530 (PIK3CD)
   05160 Hepatitis C
    102500530 (PIK3CD)
   05171 Coronavirus disease - COVID-19
    102500530 (PIK3CD)
   05164 Influenza A
    102500530 (PIK3CD)
   05162 Measles
    102500530 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    102500530 (PIK3CD)
   05163 Human cytomegalovirus infection
    102500530 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102500530 (PIK3CD)
   05169 Epstein-Barr virus infection
    102500530 (PIK3CD)
   05165 Human papillomavirus infection
    102500530 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102500530 (PIK3CD)
   05142 Chagas disease
    102500530 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102500530 (PIK3CD)
   01524 Platinum drug resistance
    102500530 (PIK3CD)
   01522 Endocrine resistance
    102500530 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tup04131]
    102500530 (PIK3CD)
Enzymes [BR:tup01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102500530 (PIK3CD)
Membrane trafficking [BR:tup04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102500530 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2
Other DBs
NCBI-GeneID: 102500530
NCBI-ProteinID: XP_006145430
LinkDB
Position
Un
AA seq 1044 aa
MPPGVDCPMEFWTKEENQNVAVDFLLPTGIYLNFPVSRNANLSTIKQVLWHRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDVQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSLRDPEVNDFRAKMRQFCEEAAARRQQLGWEAWLQYSFPLQLEPSAPSLRA
STLRGPNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVFRQPLLEQPEDYT
LQVNGRHEYLYGSYPLCQFQYICSCLHSGQTPHLTMVHSSSILAMRDEQSNPAPQVQKPR
TKPPPVPVKKLSSVSLWSLEQPFCIELIQGSKVNADERMKLVVQAGLFHGNEMLCKTVSS
CEVSVCSEPVWKQRLEFDINICDLPRMARLCFALYAVIEKTRKARATKKKSKKADCPIAW
ANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPTGTVRSNPNTESAAALVICLPEVAP
HPVYYPALEKILELGRPGERGRFTEEEQLQLREILERRGSGELYEHEKDLVWKMRHEVQE
HFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCHVGSFAIKSL
RKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPSV
ALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKELMHLCMR
QETYLEALSHLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWIMYSNEEAGSDGSVGIIFKN
GDDLRQDMLTLQMIQLMDILWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIANIQLN
KSNMAATAAFNKDALLNWLKSKNPGDTLDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIM
IRESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYC
ERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFN
EALRESWKTKVNWLAHNVSKDNRQ
NT seq 3135 nt   +upstreamnt  +downstreamnt
atgccccctggggttgactgccccatggaattctggaccaaggaggagaatcagaacgtg
gcggttgacttcctgctgcccacagggatctacctgaacttccccgtgtcccgcaatgcc
aacctcagcaccatcaagcaggtgctgtggcaccgcgcccagtatgagccgctgttccac
atgctcagcgaccccgaggcctacgtgttcacctgcgtcaaccagacggcggagcagcag
gagctggaggacgagcagcggcggctgtgcgatgtgcagcccttcctgccggtgctgcgc
ctggtggcccgcgagggtgaccgtgtgaagaagctcatcaactcccagatcagcctcctc
atcggcaaaggcctccacgaatttgactccttgcgcgaccccgaggtgaacgacttccgt
gccaagatgcgccagttctgcgaggaggcggcggcccgccggcagcagctgggctgggag
gcctggctgcagtacagcttccccctgcagctggagccctcagcacccagcctgagggcc
agcaccctgcggggccccaaccgcgccctcctggtcaatgtcaagtttgaaggcagtgag
gagagcttcaccttccaggtgtccaccaaggacatgcccctggcactgatggcctgcgcc
ctccggaagaaggccacggtattccggcagcccctgctggagcagcccgaggactacacg
ctgcaagtgaatgggaggcatgagtacctctacggcagctaccccctctgccagttccag
tacatctgcagctgcctgcacagcgggcagacccctcacctgaccatggtccactcctcc
tccatcctcgccatgcgggacgagcagagcaaccctgccccccaagtccagaaacctcgc
accaaaccgccccctgttcccgtaaagaagctgtcctccgtgtccctgtggtccctggag
cagccgttctgcatcgagctgatccagggcagcaaagtgaacgcagacgagcggatgaag
ctggtggtgcaggctgggctgttccatggcaacgagatgctgtgcaagacggtgtccagt
tgcgaggtcagcgtgtgctcggagcccgtgtggaagcagcggctggagttcgacatcaac
atctgtgacctgcctcgcatggcccggctctgcttcgccctctatgccgtcatcgagaag
accaggaaggctcgtgccaccaaaaagaagtccaagaaggcggactgccccatcgcctgg
gccaacctcatgctgtttgactacaaggaccagctcaagaccggggagcgctgcctctac
atgtggccgtccgtcccagatgagaaaggggagctactgaaccccacgggtactgtgcgc
agtaaccccaacacggagagtgctgccgccctggtcatctgcctgcccgaggtggccccc
caccccgtgtactaccctgccctggagaagatcctagagctggggcggcccggagagcgc
gggcgcttcactgaggaggagcaactgcagctgagggaaatcctggagcggcgggggtct
ggggagctatatgagcacgagaaggacctggtgtggaagatgcggcatgaagtccaggag
cacttcccggaggcgctggcccgactgctgctggtcactaagtggaacaagcatgaggat
gtggcccagatgctctacctgttgtgctcctggcccgagctgcccgtcctgagcgccctg
gagctgctggacttcagcttccccgactgccacgtgggctccttcgccatcaagtccctg
cggaaactgacggacgacgagcttttccagtacctgctgcagctggtgcaggttctcaag
tacgagtcctacttggactgcgagctgaccaaattcttgctggaccgggccctggccaac
cgcaagatcggccacttcctcttctggcacctccgctctgagatgcacgtcccgtcagtg
gccctgcgctttggcctcatcatggaggcctattgcaggggcagcacccaccacatgaaa
gtgctgatgaagcagggggaagcactgagcaaactgaaggccctgaacgacttcgtcaag
gtcagctcccagaagaccaccaagccccagaccaaggagctgatgcacctatgcatgcgc
caggagacctacctggaggccctctcccacctgcagtcccccctcgaccccagcaccctg
ctggctgaagtctgtgtggagcagtgcaccttcatggactccaagatgaagccgctgtgg
atcatgtacagcaacgaggaggcgggcagtgatggcagcgtgggcatcatcttcaagaac
ggggatgacctgcgccaggacatgctgactctgcagatgatccagctcatggacatcctg
tggaagcaggagggcctggacctcaggatgaccccctatggctgcctccccactggagac
cgcacgggcctcattgaagtggtgcttcactcagacaccatcgccaacatccagctgaac
aagagcaacatggcggccacagccgccttcaacaaggatgccctgctcaactggctcaag
tccaagaaccctggcgacaccctggaccgagccattgaggagttcaccctttcctgtgct
ggctactgtgtggccacgtacgtgctgggcatcggcgaccggcacagcgacaacatcatg
atccgcgagagcgggcagctgttccacattgattttggccacttcctggggaatttcaag
accaagtttggaatcaaccgtgagcgagtgcccttcatcctcacctatgactttgtccat
gtgattcagcagggaaagacgaataatagtgagaaatttgaaaggttccggggctactgt
gagagagcctacaccatcctgcggcgccacgggctgctcttcctccacctctttgccctg
atgcgggcggcaggcctgcctgagctcagctgctccaaagacatccagtatctcaaggac
tctctggcactgggaaagacggaggaggaggctctgaagcacttccgagtgaagttcaac
gaagccctccgggagagctggaaaaccaaagtgaactggctggcccacaacgtgtccaaa
gataacaggcaatag

KEGG   Tupaia chinensis (Chinese tree shrew): 102502163
Entry
102502163         CDS       T02978                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00562  Inositol phosphate metabolism
tup01100  Metabolic pathways
tup01521  EGFR tyrosine kinase inhibitor resistance
tup01522  Endocrine resistance
tup01524  Platinum drug resistance
tup04012  ErbB signaling pathway
tup04014  Ras signaling pathway
tup04015  Rap1 signaling pathway
tup04024  cAMP signaling pathway
tup04062  Chemokine signaling pathway
tup04066  HIF-1 signaling pathway
tup04068  FoxO signaling pathway
tup04070  Phosphatidylinositol signaling system
tup04071  Sphingolipid signaling pathway
tup04072  Phospholipase D signaling pathway
tup04140  Autophagy - animal
tup04150  mTOR signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04152  AMPK signaling pathway
tup04210  Apoptosis
tup04211  Longevity regulating pathway
tup04213  Longevity regulating pathway - multiple species
tup04218  Cellular senescence
tup04360  Axon guidance
tup04370  VEGF signaling pathway
tup04380  Osteoclast differentiation
tup04510  Focal adhesion
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04611  Platelet activation
tup04613  Neutrophil extracellular trap formation
tup04620  Toll-like receptor signaling pathway
tup04625  C-type lectin receptor signaling pathway
tup04630  JAK-STAT signaling pathway
tup04650  Natural killer cell mediated cytotoxicity
tup04660  T cell receptor signaling pathway
tup04662  B cell receptor signaling pathway
tup04664  Fc epsilon RI signaling pathway
tup04666  Fc gamma R-mediated phagocytosis
tup04668  TNF signaling pathway
tup04670  Leukocyte transendothelial migration
tup04722  Neurotrophin signaling pathway
tup04725  Cholinergic synapse
tup04750  Inflammatory mediator regulation of TRP channels
tup04810  Regulation of actin cytoskeleton
tup04910  Insulin signaling pathway
tup04914  Progesterone-mediated oocyte maturation
tup04915  Estrogen signaling pathway
tup04917  Prolactin signaling pathway
tup04919  Thyroid hormone signaling pathway
tup04923  Regulation of lipolysis in adipocytes
tup04926  Relaxin signaling pathway
tup04929  GnRH secretion
tup04930  Type II diabetes mellitus
tup04931  Insulin resistance
tup04932  Non-alcoholic fatty liver disease
tup04933  AGE-RAGE signaling pathway in diabetic complications
tup04935  Growth hormone synthesis, secretion and action
tup04960  Aldosterone-regulated sodium reabsorption
tup04973  Carbohydrate digestion and absorption
tup05010  Alzheimer disease
tup05017  Spinocerebellar ataxia
tup05020  Prion disease
tup05100  Bacterial invasion of epithelial cells
tup05132  Salmonella infection
tup05135  Yersinia infection
tup05142  Chagas disease
tup05146  Amoebiasis
tup05160  Hepatitis C
tup05161  Hepatitis B
tup05162  Measles
tup05163  Human cytomegalovirus infection
tup05164  Influenza A
tup05165  Human papillomavirus infection
tup05166  Human T-cell leukemia virus 1 infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05168  Herpes simplex virus 1 infection
tup05169  Epstein-Barr virus infection
tup05170  Human immunodeficiency virus 1 infection
tup05171  Coronavirus disease - COVID-19
tup05200  Pathways in cancer
tup05203  Viral carcinogenesis
tup05205  Proteoglycans in cancer
tup05206  MicroRNAs in cancer
tup05210  Colorectal cancer
tup05211  Renal cell carcinoma
tup05212  Pancreatic cancer
tup05213  Endometrial cancer
tup05214  Glioma
tup05215  Prostate cancer
tup05218  Melanoma
tup05220  Chronic myeloid leukemia
tup05221  Acute myeloid leukemia
tup05222  Small cell lung cancer
tup05223  Non-small cell lung cancer
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
tup05230  Central carbon metabolism in cancer
tup05231  Choline metabolism in cancer
tup05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tup05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102502163 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102502163 (PIK3CB)
   04014 Ras signaling pathway
    102502163 (PIK3CB)
   04015 Rap1 signaling pathway
    102502163 (PIK3CB)
   04370 VEGF signaling pathway
    102502163 (PIK3CB)
   04630 JAK-STAT signaling pathway
    102502163 (PIK3CB)
   04668 TNF signaling pathway
    102502163 (PIK3CB)
   04066 HIF-1 signaling pathway
    102502163 (PIK3CB)
   04068 FoxO signaling pathway
    102502163 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    102502163 (PIK3CB)
   04072 Phospholipase D signaling pathway
    102502163 (PIK3CB)
   04071 Sphingolipid signaling pathway
    102502163 (PIK3CB)
   04024 cAMP signaling pathway
    102502163 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    102502163 (PIK3CB)
   04152 AMPK signaling pathway
    102502163 (PIK3CB)
   04150 mTOR signaling pathway
    102502163 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102502163 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    102502163 (PIK3CB)
   04218 Cellular senescence
    102502163 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102502163 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    102502163 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102502163 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102502163 (PIK3CB)
   04613 Neutrophil extracellular trap formation
    102502163 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    102502163 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    102502163 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    102502163 (PIK3CB)
   04660 T cell receptor signaling pathway
    102502163 (PIK3CB)
   04662 B cell receptor signaling pathway
    102502163 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    102502163 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    102502163 (PIK3CB)
   04670 Leukocyte transendothelial migration
    102502163 (PIK3CB)
   04062 Chemokine signaling pathway
    102502163 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102502163 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    102502163 (PIK3CB)
   04929 GnRH secretion
    102502163 (PIK3CB)
   04915 Estrogen signaling pathway
    102502163 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    102502163 (PIK3CB)
   04917 Prolactin signaling pathway
    102502163 (PIK3CB)
   04926 Relaxin signaling pathway
    102502163 (PIK3CB)
   04935 Growth hormone synthesis, secretion and action
    102502163 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    102502163 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102502163 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102502163 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    102502163 (PIK3CB)
   04722 Neurotrophin signaling pathway
    102502163 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102502163 (PIK3CB)
  09158 Development and regeneration
   04360 Axon guidance
    102502163 (PIK3CB)
   04380 Osteoclast differentiation
    102502163 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    102502163 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    102502163 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102502163 (PIK3CB)
   05206 MicroRNAs in cancer
    102502163 (PIK3CB)
   05205 Proteoglycans in cancer
    102502163 (PIK3CB)
   05203 Viral carcinogenesis
    102502163 (PIK3CB)
   05230 Central carbon metabolism in cancer
    102502163 (PIK3CB)
   05231 Choline metabolism in cancer
    102502163 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102502163 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102502163 (PIK3CB)
   05212 Pancreatic cancer
    102502163 (PIK3CB)
   05225 Hepatocellular carcinoma
    102502163 (PIK3CB)
   05226 Gastric cancer
    102502163 (PIK3CB)
   05214 Glioma
    102502163 (PIK3CB)
   05221 Acute myeloid leukemia
    102502163 (PIK3CB)
   05220 Chronic myeloid leukemia
    102502163 (PIK3CB)
   05218 Melanoma
    102502163 (PIK3CB)
   05211 Renal cell carcinoma
    102502163 (PIK3CB)
   05215 Prostate cancer
    102502163 (PIK3CB)
   05213 Endometrial cancer
    102502163 (PIK3CB)
   05224 Breast cancer
    102502163 (PIK3CB)
   05222 Small cell lung cancer
    102502163 (PIK3CB)
   05223 Non-small cell lung cancer
    102502163 (PIK3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102502163 (PIK3CB)
   05017 Spinocerebellar ataxia
    102502163 (PIK3CB)
   05020 Prion disease
    102502163 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102502163 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102502163 (PIK3CB)
   04932 Non-alcoholic fatty liver disease
    102502163 (PIK3CB)
   04931 Insulin resistance
    102502163 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102502163 (PIK3CB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102502163 (PIK3CB)
   05135 Yersinia infection
    102502163 (PIK3CB)
   05100 Bacterial invasion of epithelial cells
    102502163 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102502163 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    102502163 (PIK3CB)
   05161 Hepatitis B
    102502163 (PIK3CB)
   05160 Hepatitis C
    102502163 (PIK3CB)
   05171 Coronavirus disease - COVID-19
    102502163 (PIK3CB)
   05164 Influenza A
    102502163 (PIK3CB)
   05162 Measles
    102502163 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    102502163 (PIK3CB)
   05163 Human cytomegalovirus infection
    102502163 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102502163 (PIK3CB)
   05169 Epstein-Barr virus infection
    102502163 (PIK3CB)
   05165 Human papillomavirus infection
    102502163 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102502163 (PIK3CB)
   05142 Chagas disease
    102502163 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102502163 (PIK3CB)
   01524 Platinum drug resistance
    102502163 (PIK3CB)
   01522 Endocrine resistance
    102502163 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tup04131]
    102502163 (PIK3CB)
Enzymes [BR:tup01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102502163 (PIK3CB)
Membrane trafficking [BR:tup04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102502163 (PIK3CB)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C DUF4381
Other DBs
NCBI-GeneID: 102502163
NCBI-ProteinID: XP_006158240
LinkDB
Position
Un
AA seq 1064 aa
MPPAMADVLDIWAVDSQIASDGSIPVDFLLPTGIYIQMEVPREATISYIKQMLWKQVHNY
PMFNLLMEVDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGEKLDSKI
GVLIGKGLHEFDALKDPEVNEFRRKMRKFSEEKIQSLVGLSWMDWLKQTYPPEHEPSVLE
NLEDKLYGGKLIVAVHFENSQDVFSFQVSPNMSPIKVNELAIQKRLTIHGKEDEASPCDY
VLQVSGRVEYVFGDHPLIQFQYVRNCVMSRTLPHFILVECCKIKKMYEQEMLAIEGAIQR
SSSTPPLPLPPKKTRIISHIWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHGTELLCK
TIVSSEISGKNDHVWNEPLEFDINICDLPRMARLCFAVYAVLDKVKTKKSTKTINPSKYQ
TIRKAGKVHYPVAWVNTMVFDFKGQLRSGDVILHSWSSFPDELEEMLNPMGTVQTNPYTE
NATALHIKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLAVLKEILDRDP
LSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPKLPPREA
LELLDFNYPDQYVREYAVECLQQMSDEELSQYLLQLVQVLKYEPFLDCALSRFLLERALA
NRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKVLSKQVEALNKLKTLNSLI
KLNAMKLNRAKGKEAMHTCLKQNAYREALSDLQSPLNPCVILSELYVEKCKYMDSKMKPL
WLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYGCLATGD
RSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEEFTLSCA
GYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFILTYDFIH
VIQQGKTGNTEKFGRFRQCCEDAYLVLRRHGNLFITLFALMLTAGLPELTSVKDIQYLKD
SLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3195 nt   +upstreamnt  +downstreamnt
atgcctcctgctatggcggacgtccttgacatctgggccgtggactcgcagatcgcgtcc
gatggctccatccccgtggatttcctcttgcccactgggatctacattcagatggaggtg
cctcgggaagcgaccatttcttacattaagcagatgttatggaagcaagttcacaattac
cccatgtttaacctccttatggaagtggactcctacatgttcgcgtgtgtgaaccagacc
gccgtgtatgaggagctcgaagatgaaacacggagactctgcgacgtcaggcctttcctg
ccggtcctcaaattagtgacaagaagctgcgacccaggggaaaaactagattcaaaaatc
ggagttctcataggaaaaggtctgcatgaatttgatgccttgaaggatccagaagtgaat
gaatttcgaaggaaaatgcgcaaattcagcgaggaaaagattcagtcgctggttggattg
tcttggatggactggctgaagcagacatacccacccgagcatgagccgtctgtccttgaa
aacttagaagataaactttatggagggaagctcatcgtggctgttcattttgaaaatagt
caggatgtgtttagctttcaagtatctcctaacatgagccctatcaaagtaaatgagctc
gcgatccagaaacgcttgactattcacgggaaggaggacgaggcgagcccctgtgactat
gtgctgcaggtcagtgggagagtggagtacgtgttcggcgatcacccgctgatccagttc
cagtacgtccggaactgcgtaatgagcaggacgctgccccatttcattcttgtggagtgc
tgtaagattaagaagatgtacgagcaggagatgttggccatagaaggtgccatacagcgg
agctcgtccacccctcctctccccttgccgccaaagaaaacgcgaattatttctcacatc
tgggagaataacaaccctttccaaatcgttctggttaagggcaataaactgaacacagaa
gaaactgtaaaggttcatgtcagagctggtctttttcacggtactgagctcttgtgtaaa
accatcgtgagctcagagatatcaggaaagaacgaccacgtttggaacgagccgctggag
ttcgatattaacatatgtgacttgccgaggatggcacggttatgtttcgctgtttacgcg
gttttggataaagtgaagacgaagaaatcaactaaaactattaatccctctaaataccag
accatcaggaaagctggaaaagtgcattatcccgtagcgtgggtgaacaccatggttttc
gacttcaaaggacagctgagatctggagacgtaatactgcatagctggtcttcatttcct
gatgaacttgaagaaatgttgaatccaatgggaaccgttcaaacaaatccatatactgaa
aacgcaacagctttgcatatcaagtttccagagaataaaaaacagccttattactatcct
ccctttgataagattattgagaaggcagctgagatcgcaagcagtgatagtgctaatgta
tcaagtcggggtggaaaaaagtttcttgctgtcctgaaggagatcttggacagggacccc
ctgtctcagctgtgtgagaatgagatggatcttatctggactctgcgacaggactgcaga
gagaacttcccacagtcactgcccaagctgctgctgtcgatcaagtggaataagcttgag
gacgttgctcagctccaagcactgcttcagatttggcccaaactgcccccgcgggaggcc
ctggagcttctggacttcaactacccagaccagtacgtgcgggaatatgccgtggagtgc
ctgcaacagatgagtgatgaagaactctcgcagtaccttttacaactggtgcaagtgtta
aaatacgagcctttccttgattgtgccctgtctagattcctgctagaaagggcacttgct
aatcggaggataggacagtttctgttttggcatcttaggtccgaagtgcacattcccgcc
gtctcagtgcagttcggcgtcatcctggaagcttattgccggggaagcgtaggtcacatg
aaagtgctttccaaacaggttgaagcactcaataaattaaaaactttaaatagtttaatc
aaactgaatgcaatgaagctaaacagagccaaagggaaggaagccatgcacacctgttta
aaacagaatgcttaccgggaagctctctctgacctgcagtcacccctgaacccgtgtgtt
atcctctcagagctctatgttgaaaaatgcaaatacatggattctaaaatgaagcctttg
tggctggtgtataacaacaaagtatttggtgaggactcagttggagttatttttaaaaat
ggtgatgatttacgacaggatatgctgaccctccagatgctgcgactgatggatttactc
tggaaggaagcgggactggatcttcggatgctgccctacggctgcctcgccacaggagac
cgctccggcctcatcgaagtcgtgagcacctccgagaccatcgctgacattcagctgaac
agcagcaatgtggccgccgccgccgccttcaacaaggacgcccttctcaactggctgaaa
gagtacaactctggggatgacctggaccgagccattgaagaatttaccctgtcttgtgct
ggctactgtgtagcttcttacgtccttgggattggtgacagacatagtgacaatattatg
gtcaaaaaaactggccagctcttccacattgattttggacatattctcggaaatttcaaa
tctaaatttggtattaaaagggagcgagtgccttttatccttacctatgacttcattcat
gtcattcaacaaggaaaaacggggaacacggaaaagtttggccggttccgccagtgctgt
gaggacgcgtacctggtcttgcgccgccacgggaacctcttcattaccctgttcgccctg
atgctgaccgccggcctgcccgagctcacgtccgtcaaggatattcagtatcttaaggat
tctcttgccttagggaagagtgaagaagaagcactcaaacaatttaagcaaaagttcgac
gaggcgctcagggaaagctggacgactaaggtgaactggatggcccacacggtgcggaaa
gactacagatcctaa

KEGG   Tupaia chinensis (Chinese tree shrew): 106736453
Entry
106736453         CDS       T02978                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform-like
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00562  Inositol phosphate metabolism
tup01100  Metabolic pathways
tup01521  EGFR tyrosine kinase inhibitor resistance
tup01522  Endocrine resistance
tup01524  Platinum drug resistance
tup04012  ErbB signaling pathway
tup04014  Ras signaling pathway
tup04015  Rap1 signaling pathway
tup04024  cAMP signaling pathway
tup04062  Chemokine signaling pathway
tup04066  HIF-1 signaling pathway
tup04068  FoxO signaling pathway
tup04070  Phosphatidylinositol signaling system
tup04071  Sphingolipid signaling pathway
tup04072  Phospholipase D signaling pathway
tup04140  Autophagy - animal
tup04150  mTOR signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04152  AMPK signaling pathway
tup04210  Apoptosis
tup04211  Longevity regulating pathway
tup04213  Longevity regulating pathway - multiple species
tup04218  Cellular senescence
tup04360  Axon guidance
tup04370  VEGF signaling pathway
tup04380  Osteoclast differentiation
tup04510  Focal adhesion
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04611  Platelet activation
tup04613  Neutrophil extracellular trap formation
tup04620  Toll-like receptor signaling pathway
tup04625  C-type lectin receptor signaling pathway
tup04630  JAK-STAT signaling pathway
tup04650  Natural killer cell mediated cytotoxicity
tup04660  T cell receptor signaling pathway
tup04662  B cell receptor signaling pathway
tup04664  Fc epsilon RI signaling pathway
tup04666  Fc gamma R-mediated phagocytosis
tup04668  TNF signaling pathway
tup04670  Leukocyte transendothelial migration
tup04722  Neurotrophin signaling pathway
tup04725  Cholinergic synapse
tup04750  Inflammatory mediator regulation of TRP channels
tup04810  Regulation of actin cytoskeleton
tup04910  Insulin signaling pathway
tup04914  Progesterone-mediated oocyte maturation
tup04915  Estrogen signaling pathway
tup04917  Prolactin signaling pathway
tup04919  Thyroid hormone signaling pathway
tup04923  Regulation of lipolysis in adipocytes
tup04926  Relaxin signaling pathway
tup04929  GnRH secretion
tup04930  Type II diabetes mellitus
tup04931  Insulin resistance
tup04932  Non-alcoholic fatty liver disease
tup04933  AGE-RAGE signaling pathway in diabetic complications
tup04935  Growth hormone synthesis, secretion and action
tup04960  Aldosterone-regulated sodium reabsorption
tup04973  Carbohydrate digestion and absorption
tup05010  Alzheimer disease
tup05017  Spinocerebellar ataxia
tup05020  Prion disease
tup05100  Bacterial invasion of epithelial cells
tup05132  Salmonella infection
tup05135  Yersinia infection
tup05142  Chagas disease
tup05146  Amoebiasis
tup05160  Hepatitis C
tup05161  Hepatitis B
tup05162  Measles
tup05163  Human cytomegalovirus infection
tup05164  Influenza A
tup05165  Human papillomavirus infection
tup05166  Human T-cell leukemia virus 1 infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05168  Herpes simplex virus 1 infection
tup05169  Epstein-Barr virus infection
tup05170  Human immunodeficiency virus 1 infection
tup05171  Coronavirus disease - COVID-19
tup05200  Pathways in cancer
tup05203  Viral carcinogenesis
tup05205  Proteoglycans in cancer
tup05206  MicroRNAs in cancer
tup05210  Colorectal cancer
tup05211  Renal cell carcinoma
tup05212  Pancreatic cancer
tup05213  Endometrial cancer
tup05214  Glioma
tup05215  Prostate cancer
tup05218  Melanoma
tup05220  Chronic myeloid leukemia
tup05221  Acute myeloid leukemia
tup05222  Small cell lung cancer
tup05223  Non-small cell lung cancer
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
tup05230  Central carbon metabolism in cancer
tup05231  Choline metabolism in cancer
tup05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tup05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    106736453
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106736453
   04014 Ras signaling pathway
    106736453
   04015 Rap1 signaling pathway
    106736453
   04370 VEGF signaling pathway
    106736453
   04630 JAK-STAT signaling pathway
    106736453
   04668 TNF signaling pathway
    106736453
   04066 HIF-1 signaling pathway
    106736453
   04068 FoxO signaling pathway
    106736453
   04070 Phosphatidylinositol signaling system
    106736453
   04072 Phospholipase D signaling pathway
    106736453
   04071 Sphingolipid signaling pathway
    106736453
   04024 cAMP signaling pathway
    106736453
   04151 PI3K-Akt signaling pathway
    106736453
   04152 AMPK signaling pathway
    106736453
   04150 mTOR signaling pathway
    106736453
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106736453
  09143 Cell growth and death
   04210 Apoptosis
    106736453
   04218 Cellular senescence
    106736453
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106736453
   04550 Signaling pathways regulating pluripotency of stem cells
    106736453
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106736453
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    106736453
   04613 Neutrophil extracellular trap formation
    106736453
   04620 Toll-like receptor signaling pathway
    106736453
   04625 C-type lectin receptor signaling pathway
    106736453
   04650 Natural killer cell mediated cytotoxicity
    106736453
   04660 T cell receptor signaling pathway
    106736453
   04662 B cell receptor signaling pathway
    106736453
   04664 Fc epsilon RI signaling pathway
    106736453
   04666 Fc gamma R-mediated phagocytosis
    106736453
   04670 Leukocyte transendothelial migration
    106736453
   04062 Chemokine signaling pathway
    106736453
  09152 Endocrine system
   04910 Insulin signaling pathway
    106736453
   04923 Regulation of lipolysis in adipocytes
    106736453
   04929 GnRH secretion
    106736453
   04915 Estrogen signaling pathway
    106736453
   04914 Progesterone-mediated oocyte maturation
    106736453
   04917 Prolactin signaling pathway
    106736453
   04926 Relaxin signaling pathway
    106736453
   04935 Growth hormone synthesis, secretion and action
    106736453
   04919 Thyroid hormone signaling pathway
    106736453
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    106736453
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    106736453
  09156 Nervous system
   04725 Cholinergic synapse
    106736453
   04722 Neurotrophin signaling pathway
    106736453
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    106736453
  09158 Development and regeneration
   04360 Axon guidance
    106736453
   04380 Osteoclast differentiation
    106736453
  09149 Aging
   04211 Longevity regulating pathway
    106736453
   04213 Longevity regulating pathway - multiple species
    106736453
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106736453
   05206 MicroRNAs in cancer
    106736453
   05205 Proteoglycans in cancer
    106736453
   05203 Viral carcinogenesis
    106736453
   05230 Central carbon metabolism in cancer
    106736453
   05231 Choline metabolism in cancer
    106736453
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    106736453
  09162 Cancer: specific types
   05210 Colorectal cancer
    106736453
   05212 Pancreatic cancer
    106736453
   05225 Hepatocellular carcinoma
    106736453
   05226 Gastric cancer
    106736453
   05214 Glioma
    106736453
   05221 Acute myeloid leukemia
    106736453
   05220 Chronic myeloid leukemia
    106736453
   05218 Melanoma
    106736453
   05211 Renal cell carcinoma
    106736453
   05215 Prostate cancer
    106736453
   05213 Endometrial cancer
    106736453
   05224 Breast cancer
    106736453
   05222 Small cell lung cancer
    106736453
   05223 Non-small cell lung cancer
    106736453
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106736453
   05017 Spinocerebellar ataxia
    106736453
   05020 Prion disease
    106736453
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    106736453
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    106736453
   04932 Non-alcoholic fatty liver disease
    106736453
   04931 Insulin resistance
    106736453
   04933 AGE-RAGE signaling pathway in diabetic complications
    106736453
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106736453
   05135 Yersinia infection
    106736453
   05100 Bacterial invasion of epithelial cells
    106736453
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106736453
   05170 Human immunodeficiency virus 1 infection
    106736453
   05161 Hepatitis B
    106736453
   05160 Hepatitis C
    106736453
   05171 Coronavirus disease - COVID-19
    106736453
   05164 Influenza A
    106736453
   05162 Measles
    106736453
   05168 Herpes simplex virus 1 infection
    106736453
   05163 Human cytomegalovirus infection
    106736453
   05167 Kaposi sarcoma-associated herpesvirus infection
    106736453
   05169 Epstein-Barr virus infection
    106736453
   05165 Human papillomavirus infection
    106736453
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    106736453
   05142 Chagas disease
    106736453
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    106736453
   01524 Platinum drug resistance
    106736453
   01522 Endocrine resistance
    106736453
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tup04131]
    106736453
Enzymes [BR:tup01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     106736453
Membrane trafficking [BR:tup04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    106736453
SSDB
Motif
Pfam: PI3K_rbd PI3K_C2 PI3K_p85B PI3Ka ASC
Other DBs
NCBI-GeneID: 106736453
NCBI-ProteinID: XP_014448864
LinkDB
Position
Un
AA seq 582 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLVTIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKISHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETATKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWSEWLNYDMYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQ
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgcccccacggccgtcgtcgggtgagctgtggggcatccacttgatgcccccaagaatc
ctcgtggaatgtttactaccaaacgggatgatagtgactttagagtgcctccgtgaggcc
acgctggtgaccataaagcatgagctgtttaaagaagcaagaaagtaccccctccaccag
cttctgcaagatgagtcttcttacattttcgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgagacaagacgactttgcgaccttcggctttttcaaccgtttttaaaa
gtaatcgaacctgtaggcaaccgtgaagagaagatcctcaaccgagaaattggttttgct
atcggcatgccagtgtgtgaattcgatatggttaaagacccagaagtgcaggacttccgg
agaaacatcctgaacgtctgtaaagaagccgtggaccttagggacctcaattcacctcac
agtagggccatgtatgtctaccctccaaatgtggagtcttcgccagaactgccgaagcac
atttataataaactagacaaagggcaaataatagtggtgatctgggtaatagtttctcca
aataatgacaaacagaagtatactctgaagatcagccacgactgcgtgccagagcaggtc
attgctgaagcgatccggaagaaaactcgaagtatgctgctgtcctctgaacagctaaaa
ctctgcgtcttagaataccagggcaagtatattttaaaagtgtgtggatgtgatgaatac
ttcctagaaaaataccctctgagtcagtataagtatataagaagctgtataatgcttggg
aggatgcccaatttgatgctgatggctaaagagagtctttactcccaactgcccatggac
tgctttaccatgccgtcctactccaggcgcatctccacagccacgccgtacatgaacgga
gagaccgccacgaaatccctctgggttatcaacagcgcactcagaataaaaattctctgc
gctacatacgtgaatgtaaacattagagacatcgataagatctatgttcgaacaggtatc
taccatggaggagaacccttatgtgacaatgtgaatacccagagagtaccttgttccaat
cccaggtggagtgagtggctgaattatgacatgtacattcctgaccttcctcgcgctgct
cgactgtgtctctccatttgctctgttaaaggccgaaaaggtgctaaagaggagcactgc
ccattggcctggggaaatataaacctgttcgattacaccgacactctcgtatctggaaag
atggctttgaatctttggccagtccctcatgggttagaagacttgctgaaccctattggt
gttactgggtcaaacccaaataaagaaactccctgcttagagctggagtttgactggttc
agcagtgttgtgaagtttccggatatgtctgtgatcgaagagcatgccaactggtctgtg
tcccgcgaggcaggatttagttactcccacgcaggactgagtaacagacttgctagagac
aatgagttaagagaaaatgacaaagaacagctccgagccatctgtacccgagaccccctc
tctgaaattacggagcaagagaaagatttcctgtggagccacagacactattgtgtaact
atccctgaaattctacccaaattgcttctgtctgttaaatggaactctagagatgaagta
gcccag

DBGET integrated database retrieval system