KEGG   Tupaia chinensis (Chinese tree shrew): 102469490Help
Entry
102469490         CDS       T02978                                 

Gene name
GANC
Definition
(RefSeq) glucosidase alpha, neutral C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00052  Galactose metabolism
tup00500  Starch and sucrose metabolism
tup01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102469490 (GANC)
   00500 Starch and sucrose metabolism
    102469490 (GANC)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102469490 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 102469490
NCBI-ProteinID: XP_006158712
LinkDB All DBs
Position
Un
AA seq 914 aa AA seqDB search
MEAAEKEEISVEDEAVDRNIFRDCSKIAFYRRQKQLLSKNSTYRALLDSVTIGKDSTQFQ
ITNEARKVPLLAEVYGIEGNIFRLKINEETPLKPRYEVPDVLTSKPNSVRLISCSGDTGN
LVLADEKGELKCHIMANPFKVDLVSKEEVVLSINAQGQLYFEHLQIPLKQRAAKENEKSA
SSPTSQETQEDLGLWEEKLGKFVDVKANGPTSIGLDFSLHGFEHVYGIPQHAESHQLKNT
GDGDAYRLYNLDVYGYKIHDKMGIYGSVPYLLAHKLGRTIGIFWLNASETLVEIHTEPAV
EYTLTQLSPVAAKQKVKSRTDVRWMSESGIIDVFLLTGPTPSDVFKQYSYLTGTQAMPPL
FSLGYHQCRWNYEDEQDVKAVDAGFDTHDIPYDVMWLDIEHTEGKRYFTWDKKRFPNPKR
MQELLRSKKRKLVVISDPHIKVDPDYSVYAKAKKKGFFVKNPEGGDFEGVCWPGLSSYPD
FTNPKVREWYSDLFAFPAYQGSTDILFIWNDMNEPSVFRGPEQTMQKNAVHYGNWEHREL
HNIYGFYQQMATAEGLIKRSKWKERPFVLTRSFFAGSQKYGAVWTGDNTAEWSYLKISIP
MLLTLSITGISFCGADVGGFIGNPEAELLVRWYQAGAYQPFFRGHATMKTKRREPWLFGE
ENTRLIREAIRERYTLLPFWYFLFYRTHVASEPVMRPLWVEFPDILETFSMEEEYMLGSA
LLVRPVTEPKATMVDVFLPGLNEVWYDSKTFTRWEGGCTVKVPVSLDTIPVFQRGGSVVP
IKTTIGKSTGWMTNCPYGLRVALSTKGSAVGELYLDDGHSFQYLHQKQFLHRKFSFCSSV
LINSCADERGHYSSQCVVEQILVLGLRKEPSSVTAHLSDGKDQPVAFTYCGKTSALTLEK
LSLDVGADWEVHIK
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggaagccgctgagaaagaggaaatcagtgttgaagatgaagctgtggatagaaacatt
ttcagagactgcagcaagattgctttctacaggcgacagaaacagctgctctccaagaat
tccacctatcgggcattactagactcggtcacaataggaaaagacagcacccagttccaa
atcaccaatgaagcaagaaaggttcctctcttggctgaagtttatggtatagagggaaac
attttcaggcttaaaatcaatgaggaaacgcccctgaaacccagatatgaagttcctgat
gtcctcacaagcaagccaaactctgtacggctgatttcttgttcaggtgatacaggcaat
ctggtactggcagatgaaaaaggagagctgaagtgtcatatcatggcaaacccattcaaa
gtagacttggtatctaaagaagaggttgtgttgagcataaatgcccagggccagttatac
tttgaacacctacagattcctctcaaacaaagagctgctaaggaaaacgagaagtctgca
tcaagtcctacctcccaggaaactcaagaggatctgggcctgtgggaagagaaattggga
aaatttgtggatgtcaaagctaatggtcctacctccattggtttggatttctccttgcat
ggatttgagcatgtctatgggatcccacaacatgcagaatcacaccaacttaaaaatact
ggggatggagatgcttaccgtctttataacctggatgtctatggatataaaatacatgac
aaaatgggtatttatgggtcagtgccttacctccttgcccacaaactgggcaggactata
ggcattttctggctgaatgcctcagaaacactagtggagatccatacagagcctgcagta
gagtacacattgacccagttaagcccagttgctgctaaacaaaaggtcaaatctcgaact
gatgtgcgttggatgtcagagagtggaatcatagatgtttttctgctgacaggacctaca
ccttctgatgtcttcaaacagtactcatacctcacaggtacacaagccatgccccctctc
ttctccttggggtaccaccagtgccgctggaactatgaagatgagcaggatgtaaaagca
gtggatgcaggatttgacacccatgacattccttatgatgtcatgtggctcgacatcgag
cacactgagggcaagaggtacttcacctgggacaagaaaagattcccaaaccccaaaagg
atgcaagaactgctcaggagcaaaaaacgtaagctcgtggtcatcagtgacccacacatc
aaggttgaccctgactactcagtttatgctaaggccaagaaaaagggtttctttgtgaag
aatcctgaagggggagactttgaaggagtttgctggcctggtctctcctcttacccagat
tttaccaatcccaaggtcagagaatggtattcagatctttttgctttccctgcttatcag
ggatctacggatatcctcttcatatggaatgacatgaatgagccctctgtctttagaggg
ccagagcaaaccatgcagaaaaatgctgttcactatggcaattgggagcacagagaactt
cacaacatctatggtttttatcagcaaatggctaccgcagaaggactgatcaaaagatct
aaatggaaagagagaccctttgttcttacacgttctttctttgctgggtcacaaaagtat
ggtgctgtgtggacgggcgacaacacagcggagtggagttacctgaaaatctctatcccc
atgttactcactctcagcattactgggatctctttttgtggagctgatgtaggtgggttc
attgggaatccagaggcagaactgctggtgcgttggtaccaggctggagcctaccaaccc
ttcttccgtggccatgccactatgaaaaccaagcggcgggaaccctggctatttggtgag
gaaaacacgcggctcatccgagaagccatcagagaacgctacaccctcctgcccttttgg
tattttttgttctaccggacacacgtggcttctgaacctgtcatgaggcctctgtgggta
gagttccctgatatattagagacttttagtatggaagaggaatacatgctaggaagtgct
ttattggttcgcccagtcacggaaccaaaagccaccatggttgatgtgtttcttccagga
ctaaatgaggtctggtatgactctaagacattcactcgctgggaaggaggatgtactgtg
aaagtcccagtatccttggacactataccagtgtttcaacgaggtggaagtgtggtacca
ataaagacgactataggaaaatccacaggctggatgactaattgcccatatggactccgg
gttgctctaagcactaagggttctgcagtgggtgagttatatctggatgatggtcattca
ttccagtacctccaccagaaacaattcttacacaggaagttttcattttgttccagtgtt
ttgatcaacagttgtgccgatgagagaggtcattattccagccagtgtgtggtggagcag
atcctggtcttgggcctcaggaaggaaccttcttctgtgaccgcccacttatctgatggt
aaagaccagcctgtggcttttacatattgtggcaaaacatccgccctgaccctggagaag
ctctcactggacgttggtgctgactgggaggtccacatcaaatga

DBGET integrated database retrieval system