KEGG   Tupaia chinensis (Chinese tree shrew): 102469552
Entry
102469552         CDS       T02978                                 

Gene name
BMP2
Definition
(RefSeq) bone morphogenetic protein 2
  KO
K21283  bone morphogenetic protein 2
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04060  Cytokine-cytokine receptor interaction
tup04350  TGF-beta signaling pathway
tup04390  Hippo signaling pathway
tup05200  Pathways in cancer
tup05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    102469552 (BMP2)
   04390 Hippo signaling pathway
    102469552 (BMP2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102469552 (BMP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102469552 (BMP2)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    102469552 (BMP2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:tup04052]
    102469552 (BMP2)
   00536 Glycosaminoglycan binding proteins [BR:tup00536]
    102469552 (BMP2)
Cytokines and growth factors [BR:tup04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   102469552 (BMP2)
Glycosaminoglycan binding proteins [BR:tup00536]
 Heparan sulfate / Heparin
  Morphogens
   102469552 (BMP2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 102469552
NCBI-ProteinID: XP_014438232
LinkDB
Position
Un
AA seq 395 aa
MVAGTRCLLALLLPQVLLGGAAGLIPELGRRKFAASSGRSSSQPSDDVLSEFELRLLNMF
GLKQRPTPSRDAVVPPYMLDLYRRHSGQPGAPAPDHRLEKAASRANTVRSFHHEESLEEL
PETSGKTTRRFFFNLSSIPTEEFITSAELQVFREQMQDALGNNSSFNHRINIYEIIKPAT
TNSKFPVTRLLDTRLVNQNTSKWESFDVTPAVMRWTTQGNANHGFVVEVAHLEEKQGVSK
RHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHPL
YVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKACC
VPTELSPISMLYLDENEKVVLKNYQDMVVEGCGCR
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggtggccgggacccgctgtcttctagcgttgctgcttccccaggtcctcctgggcggc
gcggccggccttattcctgaactcggccgcaggaaatttgcggcgtcgtcgggccgctcc
tcgtcccagccctcggacgacgtcttgagcgagttcgagctgcggctgctcaacatgttc
ggcctgaagcagagacccacgcccagcagggacgccgtggtgcccccctacatgctggac
ctgtaccgccgccactcgggccagccgggcgcgcccgcccccgaccatcggctggagaag
gctgccagccgcgccaacaccgttcgcagcttccaccacgaagaatctttggaagaactg
ccagaaacaagtggaaaaacaacacgacgattcttctttaatttaagttcgatccccacc
gaggagtttatcacctcagcggaacttcaggtttttcgggaacagatgcaggatgctttg
ggaaacaatagcagttttaatcaccgcattaatatttatgaaattataaagcctgcaacc
accaactcgaaattccccgtgaccagacttttggacaccaggttagtgaatcagaacaca
agcaagtgggaaagtttcgacgtcacccctgctgtgatgcggtggaccacacagggtaac
gccaaccatggattcgtggtggaagtggctcatttggaagagaagcagggtgtctccaaa
agacacgtccggattagcaggtctttgcatcaagatgaacacagctggtcacagatcagg
ccattgctagtaacttttggccatgatggaaaagggcatccgctccacaaaagagaaaag
cgccaagcaaaacacaaacagcggaaacgcctcaagtccagctgtaagagacaccctttg
tatgtggacttcagtgacgtggggtggaatgactggattgtggcccctccagggtatcat
gctttttactgccatggggaatgcccttttcccctggctgatcacctgaactccactaat
cacgccattgttcagacgttggtcaactctgtgaattctaagattcctaaggcgtgctgt
gtcccaacagaactcagccctatctccatgctgtaccttgatgaaaatgaaaaggtggta
ttaaagaactatcaggacatggttgtggagggttgtgggtgtcgttag

KEGG   Tupaia chinensis (Chinese tree shrew): 102497487
Entry
102497487         CDS       T02978                                 

Gene name
BMP4
Definition
(RefSeq) bone morphogenetic protein 4
  KO
K04662  bone morphogenetic protein 4
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04060  Cytokine-cytokine receptor interaction
tup04350  TGF-beta signaling pathway
tup04390  Hippo signaling pathway
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04919  Thyroid hormone signaling pathway
tup05200  Pathways in cancer
tup05217  Basal cell carcinoma
tup05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    102497487 (BMP4)
   04390 Hippo signaling pathway
    102497487 (BMP4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102497487 (BMP4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102497487 (BMP4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102497487 (BMP4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102497487 (BMP4)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    102497487 (BMP4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102497487 (BMP4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:tup04052]
    102497487 (BMP4)
   00536 Glycosaminoglycan binding proteins [BR:tup00536]
    102497487 (BMP4)
Cytokines and growth factors [BR:tup04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   102497487 (BMP4)
Glycosaminoglycan binding proteins [BR:tup00536]
 Heparan sulfate / Heparin
  Morphogens
   102497487 (BMP4)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 102497487
NCBI-ProteinID: XP_006160616
UniProt: L9J8Y6
LinkDB
Position
Un
AA seq 409 aa
MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEAT
LLQMFGLRRRPQPSKSTVIPDYMRDLYRLQSGEEEEEEQTHSAGLEYPERPASRANTVRS
FHHEEHLENIPGTSENSAFRFLFNLSSIPENEVISSAELRLFREQVDQGPDWEQGFHRIN
IYEVMKPPAELVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVT
HLHQTRTHQGQHVRISRSLPQGSGDWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHPQ
RARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQT
LVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgattcctggtaaccgaatgctgatggtcgttttattatgccaagtcctgctaggaggc
gcgagccatgctagtttgatacctgagactgggaagaaaaaagtcgccgagattcagggc
cacgcgggaggacgccgctcagggcagagccatgagctcctgcgggacttcgaggcgacg
cttctgcagatgttcgggctccgccgccgcccgcagcctagcaagagcacagtcatcccg
gattacatgcgggatctttaccggctccagtctggggaggaggaggaggaagagcagacc
cacagtgcggggctggagtatcctgagcgcccagctagcagggccaacaccgtgaggagc
ttccatcacgaagaacatctggagaacatcccagggacaagtgaaaactctgcttttcgt
ttcctctttaacctcagcagcatcccagagaacgaggtcatctcctctgcagagctccgg
ctcttccgggagcaggtggaccagggccctgattgggagcagggcttccaccgaataaac
atttatgaggttatgaagcccccggcagaactggtgcctgggcacctcatcacacgacta
ctggacacaagactcgtccaccacaatgtgacacggtgggaaacttttgatgtgagccct
gcggtccttcgctggacccgggagaagcagccaaactatgggctggccattgaggtgact
cacctccaccagacacggacccaccagggccagcatgtcaggattagccgatcgttacct
caagggagtggggattgggcccagctccggcccctcctggtcacctttggccatgatggc
cggggccatgccttgacccgacgccggagggccaaacgtagccctaaacatcatccacag
agagcccggaagaagaataagaactgtcgccgccactcgctctatgtggacttcagcgat
gtaggctggaatgactggattgtggccccaccaggctaccaggccttctactgccacggg
gactgcccctttccactggctgaccacctcaactcaaccaaccatgccattgtgcagacc
ctggtcaattcggtcaattccagtatccccaaagcctgttgtgttcccactgaactgagc
gccatctccatgctatacctggatgagtatgacaaggtggtactgaaaaattatcaggag
atggtagtagagggatgtgggtgccgctga

DBGET integrated database retrieval system