KEGG   Tupaia chinensis (Chinese tree shrew): 102469597
Entry
102469597         CDS       T02978                                 

Gene name
ATP2B1
Definition
(RefSeq) ATPase plasma membrane Ca2+ transporting 1
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04020  Calcium signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04024  cAMP signaling pathway
tup04261  Adrenergic signaling in cardiomyocytes
tup04925  Aldosterone synthesis and secretion
tup04961  Endocrine and other factor-regulated calcium reabsorption
tup04970  Salivary secretion
tup04972  Pancreatic secretion
tup04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    102469597 (ATP2B1)
   04024 cAMP signaling pathway
    102469597 (ATP2B1)
   04022 cGMP-PKG signaling pathway
    102469597 (ATP2B1)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    102469597 (ATP2B1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102469597 (ATP2B1)
  09154 Digestive system
   04970 Salivary secretion
    102469597 (ATP2B1)
   04972 Pancreatic secretion
    102469597 (ATP2B1)
   04978 Mineral absorption
    102469597 (ATP2B1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    102469597 (ATP2B1)
Enzymes [BR:tup01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     102469597 (ATP2B1)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase ATP_Ca_trans_C Cation_ATPase Cation_ATPase_N Hydrolase Hydrolase_3 DUF2201_N
Other DBs
NCBI-GeneID: 102469597
NCBI-ProteinID: XP_006154876
LinkDB
Position
Un
AA seq 1249 aa
MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGIC
TKLKTSPNEGLSGNPADLERREAVFGKNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIV
SLGLSFYQPPEGDNALCGEVSVGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEKQ
FRGLQSRIEQEQKFTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQGNDLKIDE
SSLTGESDHVKKSLDKDPLLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEK
KDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEKDKKKANLPKKEKS
VLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFF
IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTL
TMNRMTVVQAYINEKHYKKVPEPEAIPPNILSYLVTGISVNCAYTSKILPPEKEGGLPRH
VGNKTECALLGLLLDLKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSYRIFS
KGASEIILKKCFKILSANGEAKVFRPRDRDDIVKTVIEPMASEGLRTICLAFRDFPAGEP
EPEWDNENDIVTGLTCIAVVGIEDPVRPEVPDAIKKCQRAGITVRMVTGDNINTARAIAT
KCGILHPGEDFLCLEGKDFNRRIRNEKGEIEQERIDKIWPKLRVLARSSPTDKHTLVKGI
IDSTVSEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVK
AVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTLASL
ALATEPPTESLLLRKPYGRNKPLISRTMMKNILGHAFYQLVVVFTLLFAGEKFFDIDSGR
NAPLHAPPSEHYTIVFNTFVLMQLFNEINARKIHGERNVFEGIFNNAIFCTIVLGTFVVQ
IIIVQFGGKPFSCSELSIEQWLWSIFLGMGTLLWGQLISTIPTSRLKFLKEAGHGTQKEE
IPEEELAEDVEEIDHAERELRRGQILWFRGLNRIQTQMDVVNAFQSGSSIQGALRRQPSI
ASQHHDIRVVNAFRSSLYEGLEKPESRSSIHNFMTHPEFRIEDSEPHIPLIDDTDAEDDA
PTKRNSSPPPSPNKNNNAVDSGIHLTIEMNKSATSSSPGSPLHSLETSL
NT seq 3750 nt   +upstreamnt  +downstreamnt
atgggcgacatggcaaacaactcagttgcatatagcggtgtgaaaaactctttgaaggaa
gctaatcatgatggggactttggaattacgctcgcggagctgcgagcactcatggagctc
aggtctacagatgcattacgaaaaatacaggaaagttatggagacgtctatggaatttgc
accaagttgaaaacatctcccaatgaaggtttaagtggaaaccctgcagatttagaaaga
agagaagcagtgtttggaaagaattttatacctcctaaaaagccaaaaacctttcttcaa
ttagtatgggaagcattacaagatgtcactttaattatattagaaattgcagccatagta
tcactgggcctttctttttatcaacctccagaaggggataatgcactttgtggagaagtt
tctgttggggaagaagaaggtgaaggtgaaactggttggattgaaggagcagcaatcctc
ttgtcagtagtatgtgtagttttagtaacagctttcaatgattggagtaaggaaaaacag
tttagaggtttgcagagtcgaattgaacaagaacagaagttcactgtcatcagaggtggt
caggtcattcagatacctgtagctgacattactgttggagatattgctcaagtgaaatat
ggtgatctccttccagctgatggcatacttattcaaggcaatgatcttaaaattgatgag
agctcattgactggtgaatctgatcatgttaagaagtctttagataaggatcccttactt
ttatcaggtactcatgtaatggaaggctctggaagaatggtagttacggctgtaggtgta
aattctcaaactggaataatttttaccttacttggagctggaggcgaagaagaagagaag
aaagatgagaagaaaaaggaaaagaaaaataagaaacaagatggagctattgagaatcgc
aataaagcaaaagctcaggatggcgcagccatggaaatgcagcctttgaagagcgaagaa
ggtggagatggtgatgaaaaagacaaaaagaaagcaaatttgccaaaaaaggaaaaatct
gttttacaagggaaacttacgaaactggctgttcagattggaaaagcaggtctgttgatg
tctgccatcacagttatcattctagtgctatattttgtaatcgataccttctgggttcaa
aagagaccatggcttgccgagtgcacaccaatttacatacaatattttgtgaagttcttc
attatcggagtcacagttttagtggttgcagttccagaagggcttccacttgcagtcact
atctcactggcttattcagtgaagaaaatgatgaaagataataatttagtaaggcatctg
gatgcttgtgagaccatgggaaatgctacagctatttgttcagataaaacaggaacattg
acaatgaaccggatgacagttgttcaagcttacataaatgaaaaacattataaaaaggtt
cctgaaccagaagctattccaccaaatattttatcctatcttgtaacaggaatttctgtg
aattgtgcttatacatcaaaaatattgccaccagagaaagagggtggattacctcgtcat
gttggtaataaaactgaatgtgccttgttgggacttcttttggatttaaagcgggattat
caggatgttagaaatgaaataccagaagaagccttgtacaaagtctacaccttcaattct
gttaggaagtccatgagtactgtcctgaaaaattcagatggaagttaccgaatattcagc
aagggtgcatctgagataattctgaaaaagtgtttcaaaatcttgagtgctaatggtgag
gcaaaagtattcagaccaagggaccgtgatgatattgtaaaaactgtgattgaaccgatg
gcatcagaaggcctgagaaccatatgtcttgcattcagagattttccagcaggagaacca
gaaccagagtgggataatgaaaatgatattgtcaccggccttacatgcattgcagttgtg
ggcattgaagatcctgtgagacctgaggtaccagatgcaataaaaaaatgtcagagggct
ggaattactgtgcgtatggtcactggtgataatattaacactgctcgagctattgctacc
aaatgtggtattttacatcctggggaagatttcctgtgcctggaaggtaaagattttaac
agaagaatacgaaatgaaaaaggagagattgagcaagaacgaatagataagatttggcca
aagcttcgagtacttgcaagatcatctcctactgacaaacatacactggttaaaggtata
attgacagcactgtctcagaacaacgccaggttgttgctgtaactggtgatggtacgaat
gatggccctgcactgaaaaaagcagatgttggatttgcaatgggtattgctggaactgat
gtagctaaagaagcatctgatattattctcacagatgataactttacaagcattgttaaa
gcagttatgtggggacgaaatgtatatgacagcatctcaaaattccttcagttccaactt
actgttaatgtagtagcagtcatagttgcttttacgggcgcctgtattactcaagattca
ccacttaaagctgtacagatgctgtgggtaaacctcataatggatacactcgcttctctg
gctctggcaacagaaccacccactgagtctctcttgcttcggaaaccatatggtagaaac
aagcctctcatctcacgcacaatgatgaagaatattttgggacatgcattttatcaactc
gtagtagtctttacactcttatttgctggggaaaagttttttgatattgatagtggaaga
aatgctcctttgcatgctcctccttcagaacattatactattgtttttaatacatttgtg
ctgatgcaacttttcaatgaaataaatgcccggaaaattcatggtgaaagaaatgtgttt
gaaggaatctttaataatgccatcttctgcacaattgttttaggaacttttgtggtacag
attataattgtgcagtttggaggaaaaccgttcagttgttcagaactctcaattgaacag
tggctatggtctatattcctaggaatgggaacattactatggggccagcttatttcaaca
attccaactagtcgtttaaaattcctaaaagaagctggccatggaacacaaaaggaagaa
atacctgaggaagaattagcagaggatgttgaagagattgatcacgcagaaagggagttg
cggcgtggccagatcttatggtttagaggtctgaacagaatccaaacacagatggatgta
gtgaatgctttccagagtggaagttccattcagggggctctaaggcggcaaccctccatc
gccagccagcatcatgatattcgagtggtgaatgcatttcgtagttctttatatgaaggg
ttagaaaaaccggaatcaagaagttctattcacaactttatgacacatcccgagtttagg
atagaagattcagagcctcatatcccccttattgatgacactgatgctgaagatgatgct
cctacaaaacgtaactccagtcctccaccctctcccaacaaaaataacaatgctgttgac
agcggaattcaccttacaatagaaatgaacaagtctgctacctcttcatccccaggaagc
ccactacatagtttggaaacatcactctga

KEGG   Tupaia chinensis (Chinese tree shrew): 102479023
Entry
102479023         CDS       T02978                                 

Gene name
ATP2B3
Definition
(RefSeq) ATPase plasma membrane Ca2+ transporting 3
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04020  Calcium signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04024  cAMP signaling pathway
tup04261  Adrenergic signaling in cardiomyocytes
tup04925  Aldosterone synthesis and secretion
tup04961  Endocrine and other factor-regulated calcium reabsorption
tup04970  Salivary secretion
tup04972  Pancreatic secretion
tup04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    102479023 (ATP2B3)
   04024 cAMP signaling pathway
    102479023 (ATP2B3)
   04022 cGMP-PKG signaling pathway
    102479023 (ATP2B3)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    102479023 (ATP2B3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102479023 (ATP2B3)
  09154 Digestive system
   04970 Salivary secretion
    102479023 (ATP2B3)
   04972 Pancreatic secretion
    102479023 (ATP2B3)
   04978 Mineral absorption
    102479023 (ATP2B3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    102479023 (ATP2B3)
Enzymes [BR:tup01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     102479023 (ATP2B3)
SSDB
Motif
Pfam: E1-E2_ATPase ATP_Ca_trans_C Cation_ATPase Cation_ATPase_N Hydrolase_3 Hydrolase Cation_ATPase_C
Other DBs
NCBI-GeneID: 102479023
NCBI-ProteinID: XP_006166768
LinkDB
Position
Un
AA seq 1162 aa
MELRGAEGLQKIQDAYGDVGGLCRRLKTSPTEGLADNSNDLEKRRQIYGQNFIPPKQPKT
FLQLVWEALQDVTLIILEVAAIVSLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEG
AAILLSVICVVLVTAFNDWSKEKQFRGLQSRIEQEQKFTVIRNGQLLQVPVAAMVVGDIA
QVKYGDLLPADGVLIQANDLKIDESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVT
AVGVNSQTGIIFTLLGAGGEEEEKKDKKGKQQDGAMESSQTKAKKQDGAVAMEMKPLKSA
EGGEVEEREKKRASVPKKEKSVLQGKLTKLAVQIGKAVFTTEAGPQTRDSAAGSREEEAP
SRAGVVLPTHQSAQKTLQRANLHCRWAGLPASTDSGPRSHVCTKMMKDNNLVRHLDACET
MGNATAICSDKTGTLTTNRMTVVQSYLGDTHYKEVPAPSALNPKILDLLVHAVSINSAYT
TKILPPEKEGALPRQVGNKTECALLGFILDLKRDFQPVREQIPEDKLYKVYTFNSVRKSM
STVIRGPDGGFRLFSKGASEILLKKCTNILNSNGELRGFRPRDRDDMVKKIIEPMACDGL
RTICIAYRDFSAGQEPDWDNESEVVAELTCIAVVGIEDPVRPEIEQERRYKVWPKLRVLA
RSSPTDKHTLVKGIIDSTTGEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEAS
DIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQVGGCTRKA
RGLRAGSRLQTFVSEMEFGGPSSNLECARTVAAEQDGPQTHSPADVTTHPPGNSHLAVLQ
EIMEEEDREGQGSGVIWEDLALISREQKPPVSNPGLSPAPAQAAPERRAAPGGELFFDVD
SGREAPQPPPGGLVSSVAVGRLSVRKCKVSGIACRKSLCAFHRITEKICPDFSANPVPQI
VIVQFGGKPFSCSPLSTEQWLWCLFVGVGELVWGQVIATIPTSQLKCLKEAGHGPGKDEM
SDEELAEGEEEIDHAERELRRGQILWFRGLNRIQTQIRVVKAFRSSLYEGLEKPESKTSI
HNFMATPEFVINDYTHNIPLIDDTDVDENEERLRAPPPPPPNQNNNAIDSGIYLTTHVTK
SATSSAFSSSPGSPLHSVETSL
NT seq 3489 nt   +upstreamnt  +downstreamnt
atggagctgcggggggccgaggggctgcagaagatccaggatgcctatggggacgtcggt
gggctctgcaggaggcttaagacctcacccacagagggcctggcggacaacagcaatgac
ctggagaagcgcaggcagatctatgggcagaacttcatccctcccaagcagcccaagacc
ttcctgcagctggtgtgggaagccctgcaggacgtgactctcatcatcctggaggtggcc
gccatcgtctccctgggcctctcattctatgcacctcctggagaagagagcgaagcctgc
gggaacgtgtcaggtggggcagaagacgagggtgaggccgaggccggctggatcgagggg
gccgccatcctgctgtctgtcatctgcgtggtgctggtcacagccttcaacgactggagc
aaggagaagcagttccgaggcctgcagagccgcatcgagcaggagcagaagttcaccgtg
attcggaatgggcagctcctgcaggtccctgtggccgcgatggtggtgggggacattgcc
caggtcaagtatggagacctgctgcctgctgacggtgtgctcatccaggccaacgacctc
aagatcgatgagagttcgctgacaggcgagtcagaccacgtgcgcaagtcggctgacaaa
gaccccatgctgctgtcgggcactcatgtcatggaaggttccggaagaatggtggtgaca
gctgtcggtgtcaactcccagacgggcatcatctttacgttgcttggagctggcggggag
gaggaggagaagaaggataagaaaggcaagcagcaggacggggcgatggagagcagccag
accaaagctaagaagcaggatggggcagtggccatggagatgaagcccctgaagagtgca
gagggcggagaggtggaggagcgggagaagaagcgggccagcgtgccaaagaaggagaag
tccgtcctgcaggggaagctcaccaagctggccgtgcagattgggaaggcagtattcacc
actgaggccggtccgcagaccagggacagcgcggctggctcccgggaggaggaggcaccc
agccgggccggggtggttctgccgacccatcagtcagcacagaagactttgcagcgagcc
aacctgcactgccgttgggcagggctgccggctagtaccgactcaggtcccaggtcccac
gtgtgcactaaaatgatgaaggacaacaacctggtgcgccacctggatgcctgcgagacc
atgggcaacgccacggccatctgctccgacaagacagggacgctcaccaccaaccgcatg
accgtggtccagtcctacctaggggacacccactacaaagaggttccagcgcccagcgcc
ctcaaccccaagatcctcgacctcctggtccacgccgtctccatcaacagtgcctacacc
accaaaatactacctccagagaaggaaggcgccctcccacgccaagtgggcaataagacc
gagtgtgccctgctgggcttcatcctggatctgaagcgagacttccagcccgtgcgggaa
cagattcccgaggacaagctttacaaagtgtacaccttcaactcggtccgcaagtccatg
agcacagtcatccgcgggcccgatggcggcttccgcctcttcagtaagggcgcctcggag
atcctgctcaaaaagtgcaccaacatcctgaacagcaacggcgaactccgaggcttccgg
cctcgggaccgggatgacatggtgaagaagatcattgagccaatggcctgcgatggcctc
cgcaccatctgcatcgcctaccgggacttctctgcaggccaggagcccgactgggacaac
gagagcgaggttgtggcggagctcacctgcatagccgtcgtgggcatcgaggaccctgtg
cggcccgagatagaacaagagcggcggtacaaggtgtggcccaagttgagggtgctcgcc
cggtcatcgcccaccgacaagcacaccctggtcaaagggatcattgacagcaccacgggt
gagcagcggcaggtggtggctgtgaccggggatggcaccaacgatgggccagccctgaag
aaggcagatgtgggcttcgccatgggcatcgctggcaccgatgtggccaaggaggcctcg
gacatcatcctgacagacgacaacttcaccagcatcgtcaaggcggtgatgtggggccgc
aacgtctacgacagcatctccaagttcctgcagttccagctgaccgtcaacgtggtggcc
gtgatcgtggccttcacgggcgcctgcatcacgcaggtgggcggctgcactcggaaggct
cgggggcttcgggccggctctcggttgcagacctttgtctcggagatggaattcggtggg
ccctcctccaacctggagtgcgcgcgcacggtggccgctgagcaggacggcccacagacc
cactcacccgctgacgtcaccactcaccctccagggaacagccacttggctgttttgcag
gagatcatggaggaggaggacagggagggccagggttctggggtcatctgggaggacctt
gctctgatttctcgggagcagaagcctcccgtcagcaacccagggctaagcccagcccca
gcgcaagctgcaccagagcggagagctgccccggggggagagctcttcttcgacgtggac
agcggcagggaagccccccagcctccccccggcgggctggtcagctcagtggcagtgggc
cggctaagcgtgcgcaagtgcaaggtgtcaggtattgcctgtcggaaaagtctatgcgct
tttcatagaataacagaaaaaatatgtcctgacttttccgccaatccagtacctcagatc
gtcatcgtgcagttcggcgggaagcccttcagctgctcgcccttgtccacggaacagtgg
ctctggtgcctgttcgttggtgtcggggagctagtctggggacaggtcatcgccaccatc
cccaccagccagctcaagtgcctgaaggaggcagggcacgggcctgggaaggatgagatg
agcgacgaggagctggccgagggggaggaggagattgaccacgccgagcgtgagctccgc
aggggccagatcctctggtttcggggcctgaaccgcattcagacgcagatccgggtggtg
aaagcattccgcagctcactctatgaaggcctggagaagccagaatccaagacctccatc
cataacttcatggcgacgcccgagtttgtgatcaacgactacacccacaacatcccgctc
atcgatgacacggacgtggacgagaacgaggagcgcctgcgggcccccccacccccaccc
ccaaaccagaacaacaacgccatagacagcggcatctacctgaccacgcatgtcaccaag
tcagctacctcttcggcgttctcttccagtcctgggagcccactccacagcgtggagacg
tccctctaa

KEGG   Tupaia chinensis (Chinese tree shrew): 102479920
Entry
102479920         CDS       T02978                                 

Gene name
ATP2B4
Definition
(RefSeq) ATPase plasma membrane Ca2+ transporting 4
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04020  Calcium signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04024  cAMP signaling pathway
tup04261  Adrenergic signaling in cardiomyocytes
tup04925  Aldosterone synthesis and secretion
tup04961  Endocrine and other factor-regulated calcium reabsorption
tup04970  Salivary secretion
tup04972  Pancreatic secretion
tup04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    102479920 (ATP2B4)
   04024 cAMP signaling pathway
    102479920 (ATP2B4)
   04022 cGMP-PKG signaling pathway
    102479920 (ATP2B4)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    102479920 (ATP2B4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102479920 (ATP2B4)
  09154 Digestive system
   04970 Salivary secretion
    102479920 (ATP2B4)
   04972 Pancreatic secretion
    102479920 (ATP2B4)
   04978 Mineral absorption
    102479920 (ATP2B4)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    102479920 (ATP2B4)
Enzymes [BR:tup01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     102479920 (ATP2B4)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase ATP_Ca_trans_C Cation_ATPase Cation_ATPase_N Hydrolase Hydrolase_3
Other DBs
NCBI-GeneID: 102479920
NCBI-ProteinID: XP_006159239
LinkDB
Position
Un
AA seq 1243 aa
MTNPSEHPLPANSMAESHEGDFGFTVMDLRKLMELRSTDALTQISTHYGGVQNICSRLKT
SPVEGLSGNPADLEKRRQVFGQNVIPPKKPKTFLELVWEALQDVTLIILEIAAVISLVLS
FYRPPGGENERCGQGRGSPEDEGEAEAGWIEGAAILFSVIIVVLVTAFNDWSKEKQFRGL
QSRIEQEQKFSIIRNGQLIQLPVAEIVVGDIAQVKYGDLLPADGILIQGNDLKIDESSLT
GESDHVKKSLDKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGASEDDEEDKKKK
GKKQGVPENRNKAKTQDGVALEIQPLNSQEGIDNEEKDKKISKVPKKEKSVLQGKLTRLA
VQIGKAGLIMSAITVLILILYFVIDNFVIQRRPWLSECTPIYIQYFVKFFIIGVTVLVVA
VPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQA
CVGGTHYHQIPSPDVFVPKVLDLIVNGISINSAYTSKILPPEKEGGLPRQVGNKTECALL
GFVTDLKQDYQAVRNEVPEEKLYKVYTFNSVRKSMSTVIKKPSGGFRMYSKGASEIILRK
CNRILDQKGEALPFKNKDRDDMVRTVIEPMASEGLRTICIAYRDFDDAEPSWDNETEILT
QLTCIAVVGIEDPVRPEVPEAIAKCKRAGITVRMVTGDNVNTARAIATKCGILTPGEDFL
CLEGKEFNRLIRNEKGEVEQEKLDKIWPKLRVLARSSPTDKHTLVKGIIDSTIGEQRQVV
AVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI
SKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTDALL
RRRPYGRNKPLISRTMMKNILGHAVYQLTVIFTLVFAGEKFFDIDSGRKAPLHSPPTQHY
TIVFNTFVLMQLFNEINSRKIHGEKNVFSGIYHNIIFCSVVLGTFICQILIVEFGGKPFS
CTQLNLAQWLWCLFIAIGELLWGQVISAIPTQSLKFLKEAGHGTAKEEITKDAEGLDEID
HAEMELRRGQILWFRGLNRIQTQIDVINTFQTGASFKGVLRRPTAGQQLDVKLVPSSSYI
KVVKAFHSSLHESIQKPKNQDSIHSFMTHPEFALDEEGPQTPLLDEREEEDLEKFSKSGT
RVLLLDGEVTPHANKNNNAVDCDQVQIVASHTDSPLHSLETSV
NT seq 3732 nt   +upstreamnt  +downstreamnt
atgacgaacccatcagaacatcccctgccggccaactcaatggccgagagccatgaaggg
gactttggtttcacagtaatggacctgaggaagctcatggagctacggtcaactgatgca
ctgacccagatcagtacccactatggaggtgtacagaatatctgcagtagactgaaaacc
tcccctgtggaaggtctgtctgggaaccctgccgatctggagaaacgtaggcaggtgttt
ggacagaacgtgatccctcccaaaaagcccaagaccttcttagagttagtgtgggaagcc
ctccaagatgtcacactcatcatcctggagatcgcggctgtcatctccctggtcctgtcc
ttctaccgcccccctggcggagagaacgaacggtgtggccagggcagaggtagcccagaa
gatgaaggggaggcagaagctggctggattgaaggggcagccatcctgttctcagtgatc
atcgtggtgttagtgaccgccttcaacgactggagcaaagagaaacaattccgagggctg
cagagccgcatcgaacaggagcagaaattctccattatccgaaatggccagctcatccag
ctccctgtggccgagatagtggtgggagacatcgcccaagtcaaatatggtgacctgctg
cctgcagatgggatcctcatccaggggaacgatctgaagattgatgagagctctctgaca
ggggaatcagaccatgtcaagaagtccctggacaaagaccccatgttgctctcaggcacc
catgtgatggaaggttctggccgaatggtagtgactgctgtgggtgtcaactcccagacc
ggaatcatcttcactctcttgggagccagtgaggatgacgaggaagacaagaagaagaaa
ggtaaaaaacaaggagtccctgaaaatcgcaacaaagcaaagacccaggacggagtggct
ctggagatccaaccactcaacagccaggaaggaatcgacaatgaggaaaaggacaagaag
atatccaaggtgcccaagaaggaaaagtcggtgttgcagggcaagctcacccggctggct
gtgcagatcgggaaagcaggtctgattatgtctgctatcacagttctcatcctcattctg
tactttgtgattgacaacttcgtcattcagcgcagaccatggctctccgagtgtactcct
atctacatccagtactttgtcaagttcttcatcatcggtgtcactgtactggtggtggct
gtgcccgaggggctgccactggctgtcaccatttcgctggcctactcggtgaagaaaatg
atgaaagacaataacctggtccgacacttggatgcttgtgagacgatgggcaatgccaca
gccatctgctccgataagacgggcacgttgaccatgaaccgcatgactgtggtacaagct
tgcgttgggggcacccattaccatcagatcccaagccctgacgtcttcgtgcccaaggtc
ctggaccttattgtcaatggcatttctatcaacagtgcttatacctccaagattctgcct
ccagagaaggagggaggcctgccgcggcaggtgggtaacaagaccgagtgtgccctgctg
ggcttcgtcactgacctgaagcaggactaccaggcagtgcgcaacgaggtgcctgaagag
aagctctacaaggtgtacaccttcaactcggtgcgcaagtcaatgagcacggtcatcaag
aagcccagcggcggcttccgcatgtacagcaagggcgcctctgagatcatcctgcgcaag
tgtaatcggatcctggaccagaaaggggaagcattgccattcaagaataaggaccgcgat
gacatggtgcgcaccgtcatcgagcccatggcctccgaggggctgcggaccatctgcata
gcgtaccgggatttcgacgatgcagagccctcgtgggacaatgagactgagatcctcact
cagctgacctgcatcgccgtggtgggcatcgaggatcccgtgcgcccagaggtaccagaa
gcgattgccaaatgtaaacgagctggcattactgtcagaatggtgacgggtgacaacgtc
aacacagcccgggccatcgccaccaaatgtggcattctgacacctggtgaagactttctg
tgcttagaaggcaaagaattcaaccgactgatccgcaatgagaaaggcgaggtggagcaa
gaaaagctggacaagatctggcctaagctccgggtcctagcacgatcgtcccccacggac
aagcacacgctggtgaaaggcatcatcgacagcactatcggggaacagcggcaggtggtg
gctgtcactggtgatggcacgaatgatgggcccgctctgaagaaagcagacgtcggtttt
gccatgggcattgcaggcacagatgtagctaaggaggcgtcggacatcatcctgacagac
gacaacttcaccagcatcgtgaaggcggtgatgtggggacgcaacgtctatgacagcatc
tctaagttcctgcagttccagctcacggtcaacgtggtggctgtgattgtggccttcact
ggagcctgtatcacacaggattccccactgaaagccgtgcagatgctgtgggtcaatcta
atcatggacacgtttgcttccttggccctggccacggagccgcctacggatgccctgttg
aggcggcgcccctacggccgaaataagcctctgatctcacgcaccatgatgaagaacatc
ttgggccatgcggtctatcagctcactgtcatctttaccctagtctttgccggtgagaag
ttctttgacatcgacagtgggcggaaggcacctctgcactcaccgcccacccagcactac
accatagttttcaacacctttgtactgatgcagctcttcaatgaaattaactcccgaaag
atccacggggagaagaacgtcttttcaggcatctaccacaacatcatcttctgctctgta
gtcttgggcacgttcatttgccagattctcattgtggagtttgggggcaaacccttcagt
tgtacacagctcaacctggcccagtggctgtggtgtctcttcatcgcaattggagaactt
ctctggggccaggtcatctctgcaatccctacccagtctctgaagttcctgaaggaggct
gggcacggcaccgccaaagaggagatcaccaaggacgccgaggggttggacgagattgac
catgcggagatggagctgcgccgaggccagatcctctggttccggggcctgaaccgcatc
cagactcagatcgacgtaattaacacattccagacgggagcctcttttaagggagtccta
aggcgaccaaccgctgggcaacaacttgatgtaaaacttgttcctagctcctcctatatc
aaagtggtcaaagcgttccatagttccctccacgaaagcattcagaagcccaagaaccaa
gactccatccacagcttcatgactcaccctgaattcgccttagatgaggaagggccgcaa
acaccactcttggatgagcgcgaggaggaagatcttgaaaagttttctaagtctggaact
cgggtgctcctgctggacggtgaggtcactccacatgccaacaaaaacaacaatgcagtg
gactgcgaccaagtgcagattgtcgcctcccacacagatagccctctgcacagcctggag
acatcagtctga

KEGG   Tupaia chinensis (Chinese tree shrew): 102496553
Entry
102496553         CDS       T02978                                 

Gene name
ATP2B2
Definition
(RefSeq) ATPase plasma membrane Ca2+ transporting 2
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04020  Calcium signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04024  cAMP signaling pathway
tup04261  Adrenergic signaling in cardiomyocytes
tup04925  Aldosterone synthesis and secretion
tup04961  Endocrine and other factor-regulated calcium reabsorption
tup04970  Salivary secretion
tup04972  Pancreatic secretion
tup04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    102496553 (ATP2B2)
   04024 cAMP signaling pathway
    102496553 (ATP2B2)
   04022 cGMP-PKG signaling pathway
    102496553 (ATP2B2)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    102496553 (ATP2B2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102496553 (ATP2B2)
  09154 Digestive system
   04970 Salivary secretion
    102496553 (ATP2B2)
   04972 Pancreatic secretion
    102496553 (ATP2B2)
   04978 Mineral absorption
    102496553 (ATP2B2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    102496553 (ATP2B2)
Enzymes [BR:tup01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     102496553 (ATP2B2)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase ATP_Ca_trans_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 EMC3_TMCO1
Other DBs
NCBI-GeneID: 102496553
NCBI-ProteinID: XP_006152044
LinkDB
Position
Un
AA seq 1243 aa
MGDMTNSDFYSKNQRNESSHGGEFGCTMEELRSLMELRGTEAVVRIKETYGDTEAICRRL
KTSPVEGLPGTAPDLEKRKQIFGQNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIISLG
LSFYHPPGENNEGCATAQGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFR
GLQSRIEQEQKFTVVRAGQVVQIPVAEIVVGDIAQVKYGDLLPADGLFIQGNDLKIDESS
LTGESDQVRKSVDKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKD
KKGVKKGDGLQLPAADGAAASNAADSANASLVNGKMQDGNVDASQSKAKQQDGAAAMEMQ
PLKSAEGGDADDKKKANMHKKEKSVLQGKLTKLAVQIGKAGLVMSAITVIILVLYFTVDT
FVVNKKPWLPECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNL
VRHLDACETMGNATAICSDKTGTLTTNRMTVVQAYVGDVHYKEIPDPSSINAKTMELLVN
AIAINSAYTTKILPPEKEGALPRQVGNKTECGLLGFVLDLKQDYEPVRSQMPEEKLYKVY
TFNSVRKSMSTVIKLPDESFRMYSKGASEIVLKKCCKILNGAGEPRVFRPRDRDEMVKKV
IEPMACDGLRTICVAYRDFPGSPEPDWDNENDILNDLTCICVVGIEDPVRPEVPEAIRKC
QRAGITVRMVTGDNINTARAIAIKCGIIHPGEDFLCLEGKEFNRRIRNEKGEIEQERIDK
IWPKLRVLARSSPTDKHTLVKGIIDSTHTEQRQVVAVTGDGTNDGPALKKADVGFAMGIA
GTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACIT
QDSPLKAVQMLWVNLIMDTFASLALATEPPTETLLLRKPYGRNKPLISRTMMKNILGHAV
YQLTLIFTLLFVGEKMFQIDSGRNAPLHSPPSEHYTIIFNTFVMMQLFNEINARKIHGER
NVFDGIFRNPIFCTIVLGTFAIQIVIVQFGGKPFSCSPLQLDQWMWCIFIGLGELVWGQV
IATIPTSRLKFLKEAGRLTQKEEIPEEELNEDVEEIDHAERELRRGQTLWFRGLNRIQTQ
IRVVKAFRSSLYEGLEKPESRTSIHNFMAHPEFRIEDSQPHIPLIDDTDLEEDAALKQNS
SPPSSLNKNNSAIDSGINLTTDTSKSATSSSPGSPIHSLETSL
NT seq 3732 nt   +upstreamnt  +downstreamnt
atgggtgacatgaccaacagcgacttttactccaaaaaccaaagaaacgagtcgagccat
gggggcgagttcgggtgcacgatggaggagctccgctccctcatggagctgcggggcact
gaggccgtggtcaggatcaaggagacctacggggacaccgaggccatctgccggcgcctc
aagacctcacctgtcgaaggcttgccgggcaccgctccagacctggagaagagaaagcag
atttttgggcaaaactttatacctccaaagaagccaaaaaccttcctgcagctcgtgtgg
gaggcgctgcaggacgtgacgctcatcatcctggaaatcgccgccatcatctccctgggg
ctctccttctaccacccgccgggcgagaacaacgaagggtgtgcgacagcccagggcggg
gcggaggatgaaggcgaggcagaggcgggttggatcgagggggctgccatcctcctctcg
gtcatctgcgtggtcctggtcacagctttcaatgactggagcaaagagaaacagttccgg
ggcctgcagagccgcatcgagcaggagcagaagttcaccgtggtccgggctggccaggtg
gtgcagatccctgtggccgagatcgtggtcggggacatcgcccaggtcaaatatggcgac
ctcctcccagctgacggcctcttcatccagggcaacgacctcaagatcgacgagagctcc
ctgacgggggagtccgaccaggtgcgcaagtccgtggacaaggaccccatgctgctgtca
gggacccacgtgatggagggctcaggacggatggtggtgaccgctgtgggtgtgaactct
cagaccggcatcatctttactctgctgggagctggtggtgaagaggaagagaagaaagac
aaaaaaggtgtgaagaagggggatggccttcagctaccagcggcagacggtgcggcggct
tcaaatgccgcagatagtgcaaatgccagcctggtcaatggtaagatgcaggatgggaat
gtggacgccagccagagcaaagccaaacagcaggacggggcagccgccatggagatgcag
cccctgaagagcgccgagggcggtgatgccgatgacaagaagaaggccaacatgcacaag
aaggagaagtccgtgctgcagggcaagctcaccaagctggctgtgcagatcggcaaggcg
ggcctggtgatgtccgctatcacagtgatcatcctggtgctctacttcaccgtggacacc
ttcgtggtcaacaagaagccgtggctgcccgagtgcacccccgtctatgtgcagtacttc
gtcaagttcttcatcatcggcgtgacggtgctggtggtcgcggtgcccgaggggctccct
ctggccgtcaccatctcgctggcctactcagtgaagaaaatgatgaaagacaacaacctg
gtacgccacctggacgcctgcgaaaccatgggcaatgccacagctatctgctcggacaag
acgggcacgctcaccaccaaccgcatgacggtggtgcaggcctacgtcggcgacgtccac
tacaaggagatccccgaccccagctccatcaacgccaagaccatggagctgctggtcaac
gccatcgccatcaacagcgcctacaccaccaagatcctgcccccagagaaggagggtgcc
ctgcctcggcaggtgggcaacaagacagagtgcggtctgctgggcttcgtgctggacctg
aagcaggactacgagcctgtgcgcagccagatgcccgaggagaagctctacaaagtgtac
accttcaactccgtgcgcaagtccatgagtaccgtcatcaagctgcccgacgagagcttc
cgcatgtacagcaagggcgcctctgagatcgtgctcaagaagtgctgcaagatcctcaat
ggggcgggtgagccccgcgtcttcaggccccgcgaccgggacgagatggtgaagaaggtg
attgagcccatggcctgcgatgggctacgcaccatctgcgtggcctacagggacttccct
ggcagccccgagcccgactgggacaacgagaacgacatcctcaacgacctcacctgcatc
tgcgtggtgggcatcgaggaccctgtgcggcctgaggtccccgaagccatccgcaagtgc
cagcgagcgggcatcaccgtgcgcatggtcactggcgacaatatcaacacggcccgggcc
atcgccatcaagtgtggcatcatccaccctggggaggactttctgtgcctcgaaggcaag
gagttcaaccggaggatccgcaacgagaagggagagattgagcaggagcgaatcgacaag
atctggccgaagctgcgggtgctggctcgctcctctcccacggacaagcacaccctggtc
aaaggcatcatcgacagcacccacaccgagcagcgccaggtggtggccgtgacgggggac
gggaccaatgacgggcctgcgcttaagaaggccgacgtgggcttcgccatgggcatcgcg
ggcactgacgtggccaaggaggcctcggacatcatcctgacggacgacaacttcagcagc
atcgtcaaggcggtgatgtggggccgcaacgtctacgacagcatctccaagttcctgcag
ttccagctgaccgtcaacgtggtggctgtgatcgtggccttcacgggcgcctgcatcacg
caggactcccccctgaaggccgtgcagatgctctgggtgaacctcatcatggacaccttc
gcctcgctggcgctggccactgagccgcccaccgagaccctgctgctgaggaagccatac
ggccgcaacaagcccctgatctcgcggaccatgatgaagaacatcctgggccacgccgtc
taccagctcaccctcatcttcaccctgctcttcgtcggcgagaagatgttccagatcgac
agcggcaggaacgcgccgctgcactcgccgccctcggagcactacaccatcatcttcaac
accttcgtcatgatgcagctcttcaacgagatcaacgcccgcaagatccacggcgagcgc
aacgtcttcgacggcatcttccggaaccccatcttctgcaccatcgtgctgggcaccttt
gccatccagatagtgatcgtgcagttcggagggaagccgttcagctgctctccgctgcag
ctggaccagtggatgtggtgcattttcatcgggttaggagagctcgtctggggccaggtc
attgccaccatcccgaccagcaggctcaagttcctcaaggaggccggcaggctcacgcag
aaggaggagattccggaggaggagctcaacgaggacgtggaggagatcgaccacgcggag
cgggagctgcggcggggccagactctctggttccggggcctgaatcggatccaaactcag
atccgcgtcgtgaaggcgttccgtagctctctctatgaaggtttagaaaagcctgagtct
cgaacctccatccataatttcatggctcatcccgaattccggatcgaagattcccagccc
cacatccccctcatcgacgacaccgacctggaagaagatgccgcgctcaaacagaactcg
agcccgccgtcgtccctcaacaagaacaacagcgccatcgacagcgggatcaacctgacg
acggacacaagcaaatcagctacctcttcaagtccagggagccccatccacagcctggag
acgtcgctttag

DBGET integrated database retrieval system