KEGG   Tupaia chinensis (Chinese tree shrew): 102470019
Entry
102470019         CDS       T02978                                 

Gene name
AIM2
Definition
(RefSeq) absent in melanoma 2
  KO
K12966  absent in melanoma 2
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04621  NOD-like receptor signaling pathway
tup04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:tup00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102470019 (AIM2)
   04623 Cytosolic DNA-sensing pathway
    102470019 (AIM2)
SSDB
Motif
Pfam: HIN PYRIN DUF5643 Adeno_E1B_55K
Other DBs
NCBI-GeneID: 102470019
NCBI-ProteinID: XP_014439774
LinkDB
Position
Un
AA seq 346 aa
MESKYKEILLLTGLDGITDEELDRFKFFLPDEFDIPKGKLKTAPRTELANLMIQNAGVVS
AVTKTIHIFQRLKYMHVAKRLQEEKEKVDKCECEKETMTVKKRSQATRRPGASAAARNDS
RVPLAALGVPPRSKSQQKQMVAEQDSPREGLQKGGLIVMVLKAMNPFEFKTQEGKQEMFH
ATVATEKEFFLVKVFNTQLKDNFTPKRTIIISNYYYRHNGILEVNSASRVFDAKPNQEVT
VPKSIIRKAGQTLKINKLQTQPLGTIVNGIYVVQKKTEQKNSVLFDLSDNTGRMEVLVPG
KQNKIECEEGDKLRLTFLELARNGEKLQLKFGAHSDIKVIKTKKKK
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggagagtaagtacaaggagatcctgttactgacgggcctggacggcatcactgacgag
gagctggaccggtttaagttcttccttccagatgagtttgacatcccaaagggcaaacta
aaaactgcacccaggacagaactagctaatttgatgattcaaaatgccggagtggtgtct
gcggtgacgaagaccattcacattttccagaggttgaaatacatgcacgtggcaaagcgt
cttcaggaagagaaggagaaagttgataaatgtgaatgtgaaaaagaaacaatgactgtg
aaaaagagaagtcaagccacaaggaggcctggtgcctctgcagctgccaggaatgacagc
agggtgccgcttgcagcactgggagtccctcctcgcagtaagtctcagcagaaacagatg
gtggccgagcaggattctcccagagaaggattgcaaaaaggcggtctgatagtcatggtg
ctgaaagcaatgaatccctttgagttcaagacccaggaagggaagcaggagatgttccat
gctacggtggctactgagaaagaattcttccttgtaaaagtttttaacacacagctaaaa
gacaacttcaccccaaagagaacaattataatatcaaactactattataggcacaatggc
atactggaggtgaacagtgcctcacgcgtgtttgatgctaaaccgaaccaagaggtcact
gtcccaaaaagcattatcagaaaagctggtcaaaccctaaagatcaataagcttcaaact
cagccccttggaaccattgtgaatgggatatatgtagtccagaagaaaacagagcagaag
aattctgtattatttgacctaagtgacaacacagggaggatggaagtactggtgcctgga
aaacagaacaaaatagaatgtgaggaaggggataagcttcgacttactttcctcgagctg
gcaagaaatggagaaaaactacagctgaaatttggagcgcatagcgacattaaggttatt
aaaactaaaaagaagaaatga

DBGET integrated database retrieval system