KEGG   Tupaia chinensis (Chinese tree shrew): 102470789
Entry
102470789         CDS       T02978                                 

Gene name
SLC26A3
Definition
(RefSeq) solute carrier family 26 member 3
  KO
K14078  solute carrier family 26 (chloride anion exchanger), member 3
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04972  Pancreatic secretion
tup04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    102470789 (SLC26A3)
   04978 Mineral absorption
    102470789 (SLC26A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tup02000]
    102470789 (SLC26A3)
Transporters [BR:tup02000]
 Solute carrier family (SLC)
  SLC26: Multifunctional anion exchanger
   102470789 (SLC26A3)
SSDB
Motif
Pfam: Sulfate_transp STAS
Other DBs
NCBI-GeneID: 102470789
NCBI-ProteinID: XP_006161204
LinkDB
Position
Un
AA seq 767 aa
MIEPIGNQYVVARPVYSVNTFAEEHKKKDRYHKTFLDHLKHCCRCSPQKAKKIALSLFPI
ASWLPAYQLQKWLLSDIVSGISTGLVAVLQGLAFALLVNIPPSYGLYAAFFPVIVYLFFG
TSRHISVGPFPVLSMMLGLAVENVASTLHVTTTNSSDSTVSNASVSMEEKVTVAATITIL
CGLIQLIMGVLQIGFVVIYLSESLISGFTTAAAVHVLVSQLKFMLQLTVPPHTDPFSIFK
VLQSIVTQIKDTNIPDLVTSLIILVIVSAVKEVNQRFKAKLPVPIPIEFIMTVIATGVSY
GFDFQHRFNVSVVGTMQKGFQPPIEPNVMIFTRAIGDSFGIAIVGFAVAFSVASVYSLKH
DYPINGNQELLAFGLCNIVTGAFRGFAGSTALSRSALRRGTGGKKIQESTGGKTQIASFF
SALIVLIVIVGIGFLLEPLQKSVLAALALGNLKGMLMQFSEIGRLWRKDKYDCLIWIMTF
IFAIVLGLGLGLAASVAFQLLTIVFRTQFPKCSTLANVGRSNIYKNKKDYSDMYEPEGVK
IFRCPSPIYFANIRFFKQKLIDAVGFSPLRILRKRNKTLKKIKKLLNEGLLQVTPEGFLC
IADGIKDSDSEEVDNNQVEELHQPITTDLPFQIDWNTYPLKVLVPQVTLHSLILDFSAVS
FLDVSSMRGLKTILQEFIRIEVDVYIVGTDDDFMEKLARCEFFDDEVKDTIFFLTIHDAI
LHILMKKDYSTSKFNFSQKKEKDFDFAINTNGSLRHRECQVPVETKF
NT seq 2304 nt   +upstreamnt  +downstreamnt
atgattgaacccatcgggaatcagtacgttgtggcccggccagtgtattctgtgaatact
tttgcagaagaacataagaagaaagacagatatcacaagacatttctggatcatctcaag
cactgttgtcgctgctccccacaaaaggccaagaaaattgccctgtctctattccccata
gcatcttggttaccagcatatcagctacagaaatggctgctcagtgacattgtttctggt
atcagcacagggctggtggctgtactgcaaggtttggcgtttgctctcctggtcaacatt
cccccaagctatggcttgtatgcagcctttttcccagttattgtgtaccttttctttggc
acttctagacacatatctgtgggtccatttccagtcctgagtatgatgttgggactagca
gttgaaaatgtagccagcacactccatgtcactaccaccaactcctctgacagcacagtg
agtaatgcttcagtgtcgatggaggagaaggtgacggtggctgcgacaatcacgatcctt
tgtgggctcatccagttgattatgggagttctgcagattggatttgtagtgatctatcta
tctgagtccctgatcagtggctttaccactgcagctgctgttcacgttttggtttcccaa
ctcaaattcatgcttcagctcacagtcccaccacacacggatccattttccattttcaaa
gttctacagtccatagtcacacaaataaaggacactaatattccagacctggtgacatcc
ctgattatactagtgattgtgtctgcggttaaagaagtgaatcagcgcttcaaagccaaa
cttccagtgcctatcccaattgaattcatcatgacggtgattgcaacgggtgtgtcctat
ggctttgacttccaacacaggtttaacgtgtctgtagtcgggactatgcaaaagggattt
cagccccctattgaacctaacgtgatgattttcacgcgcgccataggagattccttcggc
attgcaatcgttggctttgccgtggccttttccgttgccagcgtctattccctcaaacac
gactatccaattaatggcaatcaggagttgctagcctttggactgtgtaacatagtcact
ggagctttcagaggatttgcaggcagtaccgccctctccagatcagcgctccggagagga
acagggggaaaaaaaattcaggagagtacagggggcaaaacgcagattgctagctttttc
tctgctctcatcgtgctgattgtcatcgtaggcattggatttcttctggagccactacaa
aagtctgtcttggcagctttagcacttggaaacttaaagggaatgctgatgcagttttct
gaaataggcagattgtggcgcaaggataaatatgattgtttaatttggatcatgaccttc
atctttgccattgtcctggggctcgggttaggactagcagccagcgtggctttccaactg
ctgaccattgtgttcaggacccagtttccaaaatgcagcactctagctaatgttgggagg
agcaacatctataagaataaaaaagactattctgatatgtatgagccagaaggagtgaaa
attttcagatgtccatctcctatctactttgcaaatattcgtttctttaagcagaaactt
attgatgctgttggctttagtccacttcgaattctacgcaagcgcaataaaactttgaag
aaaatcaaaaaactgctgaatgaaggcctgctacaagtgaccccagaaggatttttatgt
attgctgatggcattaaagattccgacagtgaagaggtagacaacaaccaggtagaagaa
ctgcatcagccaatcaccacggacttgcccttccagatagactggaatacttatcctctc
aaagtcttagttccccaagtcactctccacagcctgattcttgatttttcagcagtgtcc
ttccttgatgtttcttcaatgaggggtctcaaaacgattttgcaagaattcatcagaatc
gaggtagatgtgtatattgttggaactgatgatgattttatggaaaagcttgctcggtgt
gaattttttgacgatgaagtcaaagacacaatttttttcttaacaatccatgacgccatt
ttgcatattttaatgaagaaagattacagtacttcaaagtttaacttcagtcagaaaaaa
gagaaagattttgattttgccataaatacaaatggaagtttacgtcatcgggaatgtcag
gtaccagttgaaacgaaattctaa

DBGET integrated database retrieval system