KEGG   Tupaia chinensis (Chinese tree shrew): 102470795
Entry
102470795         CDS       T02978                                 

Gene name
RPTOR
Definition
(RefSeq) regulatory associated protein of MTOR complex 1
  KO
K07204  regulatory associated protein of mTOR
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04136  Autophagy - other
tup04140  Autophagy - animal
tup04150  mTOR signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04152  AMPK signaling pathway
tup04211  Longevity regulating pathway
tup04213  Longevity regulating pathway - multiple species
tup04714  Thermogenesis
tup04910  Insulin signaling pathway
tup05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102470795 (RPTOR)
   04152 AMPK signaling pathway
    102470795 (RPTOR)
   04150 mTOR signaling pathway
    102470795 (RPTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102470795 (RPTOR)
   04136 Autophagy - other
    102470795 (RPTOR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102470795 (RPTOR)
  09149 Aging
   04211 Longevity regulating pathway
    102470795 (RPTOR)
   04213 Longevity regulating pathway - multiple species
    102470795 (RPTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    102470795 (RPTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    102470795 (RPTOR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tup04131]
    102470795 (RPTOR)
Membrane trafficking [BR:tup04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    102470795 (RPTOR)
SSDB
Motif
Pfam: Raptor_N HEAT HEAT_2 WD40 Cnd1 HEAT_EZ WD40_2
Other DBs
NCBI-GeneID: 102470795
NCBI-ProteinID: XP_006145730
LinkDB
Position
Un
AA seq 1335 aa
MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSV
ALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYK
QSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSVY
DLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQALEVAAINPNHPLAQMPLPPSMKNC
IQLAACEATQLLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPG
RLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSY
NCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWL
TMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLL
QSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILA
VIVNSYNTRQEACLQGNLIAICLEQLSDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSA
HEKLYSLLSDPVPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLVSDGSPMVR
KELVVALSHLVVQYESNFCTVALQFMEEEKNYPLPSPATTEGGSLTPVRDSPCTPRLRSV
SSYSNIRAVTTARSLNKSLQNLSLTEEAGSSVAFSPGNLSTSSSASSTLGSPENEEYILS
FETIDKMRRVSSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPDVSDLAMKVLNSIAYK
ATVNARPQRSLDTSSLTQSAPASPTNKGVHIQQVGGSPPASSTSSSSLTGDGTKQPASRD
LPTGRPGTAGPVGAQYTPHSHQFPRTRKMFDKGPDQTADDADDAAGHKSFISATVQTGFC
DWSARYFAQPVMKIPEEHDLESQLRKEREWRFLRNTRVRKQAQQLIQKGITRLDDQIFLN
RNPGVPSVVKFHPFTPCIAVADKDSICLWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQD
CSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWDQETGLLVS
SGDVRIVRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALS
ECRVMTYREHAAWVVKAYLQKRPEGHIVSVSVNGDVRFFDPRMPESVNALQIVKGLTALD
IHPQAHLIACGSMNQFTAVYNGNGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGS
NDYYISVYSVEKRVR
NT seq 4008 nt   +upstreamnt  +downstreamnt
atggagtccgaaatgctgcagtccccccttctgggactcggggaggaagatgaggccgac
cttacagactggaacctgcccttggcttttatgaaaaagaggcactgtgagaaaattgaa
ggctccaaatccttagctcagagctggaggatgaaggatcggatgaagacagtcagcgtg
gccttggtgctgtgcctgaacgttggtgtggaccctccagatgtggtgaagaccaccccc
tgtgcgcgtctggagtgctggattgatcctctgtccatgggtcctcagaaagctctggaa
accatcggggcaaatttacagaagcagtatgagaactggcagccacgggcgcggtacaag
cagagcctcgatccgaccgtggatgaagtcaagaaactctgcacgtctttacgccggaac
gccaaggaggagcgggtcctcttccactacaacggccacggggtgcccaggcccacggtg
aacggggaggtctgggtcttcaacaagaactacacgcagtacatcccgctgtctgtctac
gacctgcagacttggatgggcagcccgtcgatattcgtctacgactgctccaacgccggc
ctcatcgtcaagtccttcaagcagtttgcgttgcagcgggagcaggcgctggaggtggct
gcgattaacccaaaccacccactggcccagatgcctctgcccccgtccatgaaaaactgc
attcagctggcagcctgcgaggccacccagctcctgcccatgatccctgacctgccggct
gacctgttcacatcctgcctcaccacccccatcaaaatcgccctgcgctggttttgcatg
cagaaatgtgtgagtctggtgcctggtgtcacactggatttgatagaaaagatccccggg
cggctgaatgacaggaggactccgttgggtgaactgaattggatcttcacagccatcaca
gacaccatcgcgtggaacgtgctgccccgcgatctcttccagaagctcttcagacaggac
ctgttggtggccagcttgttccgaaacttcctgttggcggaaaggatcatgaggtcgtac
aactgcacccccgtcagcagcccgcgactcccgccgacttacatgcacgccatgtggcaa
gcctgggacctcgccgtggacatctgcctctctcagctgcccaccatcatcgaggaaggc
actgcattccggcacagcccgttcttcgctgagcagctgaccgccttccaggtgtggctc
acgatgggcgtggagaaccggaaccccccggagcagctgcccattgtcttacaggtgctg
ctgagccaggtgcaccggctgagggctttggacctgctgggaaggtttctggacctgggt
ccctgggcagtgagcctggccttgtctgtcggcatcttcccatacgtgctgaagctgctc
cagagctcggcccgagagctgcggccactcctggtcttcatctgggccaagatcctggcc
gtggacagctcctgccaagctgacctcgtgaaggacaacggccacaagtacttcctctcc
gtcttggcagacccctacatgccggctgagcacaggaccatgacagctttcattctggct
gtgattgtcaacagctacaacacacggcaggaagcctgcctacaaggcaacctgatcgcc
atctgcctggaacagctcagtgacccccaccccttgctgcgtcagtgggtggccatctgc
ctgggccgcatctggcagaacttcgactccgccaggtggtgcggggtgcgggacagtgcc
cacgagaagctctacagcctcctctccgaccctgttccggaggtccgctgcgcggcagtc
ttcgccctgggcacgtttgtgggcaactctgccgagaggacggaccactccaccaccatc
gaccacaacgtggccatgatgctggcccagctggtcagcgacgggagccccatggtgcgg
aaggagctggtggtggctctgagtcacctcgtcgtccagtatgaaagcaatttctgcact
gtggccctgcagttcatggaggaggaaaagaactatcccctgccctctccggccaccaca
gagggcgggagtctaaccccagtgcgggacagcccctgcacccccaggctccgttccgtg
agctcctacagcaacatccgcgccgtcaccacagcgaggagcctcaacaagtctctgcag
aatctgagcctgacggaggaagccggcagctcggtggcgttctcccccggaaacctgagc
accagcagcagcgccagcagcaccctgggcagccccgagaacgaggagtacatcctctcc
ttcgagaccatcgacaagatgcgccgcgtcagctcctactcctccctcaactccctcata
ggagtttcatttaatagtgtttacactcaaatctggagagtattattgcatctggctgct
gatccctacccagatgtgtctgatttggccatgaaagtactcaatagcatcgcctacaag
gccacggtgaacgcccggccacagcgcagcctggacacctcgtctctcacccagtcggcc
ccggccagcccgaccaacaagggcgtgcacatccagcaggtggggggctcccccccagcg
tccagcaccagcagctccagcctgacgggagacgggaccaagcagccggccagccgtgac
ctgcctacgggccggccaggcactgcgggccccgtgggggcacagtacaccccgcactcc
catcagttcccccggacacgcaagatgttcgacaagggcccagaccagaccgcggacgac
gcagacgatgctgctggacacaaaagcttcatctccgccaccgtgcagacaggcttctgc
gactggagcgcccggtacttcgcccagcccgtcatgaagatcccggaagagcacgacctg
gagagccagctgcggaaggagcgtgagtggcggttcctgcggaacacgcgtgtcaggaag
caggcgcagcagctcatccagaagggcatcacgaggctggacgaccagatatttctgaac
aggaaccccggcgtcccctccgtggtcaaatttcacccctttaccccgtgcatagctgtg
gccgacaaggacagcatctgtctctgggactgggagaagggggagaagctggactacttc
cacaacgggaacccccgctacaccagggtcaccgccatggagtatctcaacggccaggac
tgctcccttctgctgacggccacggatgatggagccatcagggtctggaagaactttgcc
gatttggagaagaacccggagatggtgacggcctggcaggggctctcagacatgctgcca
acgacccgaggagccggcatggtcgtggactgggaccaagagaccggcctcctcgtgagc
tcaggggacgtgcggattgtccggatctgggacacagaccgtgagatgaaggtgcaggac
atccccacaggggccgacagctgcgtgacgagtctttcctgcgactcccaccgctcactc
atcgtggccggcctcggcgacggctccatccgcgtctacgaccggaggatggcactcagc
gaatgccgcgtgatgacctaccgcgagcacgcggcctgggtggtgaaggcctacctccag
aagcgccccgaaggccacatcgtgagtgtgagtgtcaatggggacgtgcgcttcttcgac
ccgcggatgcccgagtcggtgaacgccctccagatagtgaaggggctgacggccctggac
atccacccccaggcacacctgatcgcctgcggctccatgaaccagttcaccgcggtctac
aatgggaacggggagctgatcaacaacatcaagtactatgacggcttcatgggccagcgc
gtcggggccatcagctgcctggccttccacccgcactggccccacctggcggtgggaagc
aacgactactacatctccgtgtactcggtggagaagcgcgtcagatag

DBGET integrated database retrieval system