KEGG   Tupaia chinensis (Chinese tree shrew): 102471083
Entry
102471083         CDS       T02978                                 

Gene name
NR3C1
Definition
(RefSeq) nuclear receptor subfamily 3 group C member 1
  KO
K05771  glucocorticoid receptor
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102471083 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tup03000]
    102471083 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:tup03310]
    102471083 (NR3C1)
Transcription factors [BR:tup03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    102471083 (NR3C1)
Nuclear receptors [BR:tup03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   102471083 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4 SCA7
Other DBs
NCBI-GeneID: 102471083
NCBI-ProteinID: XP_006144842
LinkDB
Position
Un
AA seq 777 aa
MDSKESLTSPSEEIPSSVHGQERGNVMDFYKTRRGGATVKVSTPSPSLAATSQSDSKQQR
LLVDFPKGSVSNVQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETNLQ
LLEESIANLNRSTSVPEHPKISASVAVSAALLEKELPETPSDVSSEQQNLKGQTGTNGGN
VKLCTADQSTFDILQDLEFSSASPGRETNESPWRSDLLLDENCLLSPLAVEDDPFLSEGN
LKEDCKPLILPDTKPKIKDNGDLILSSPKSVPLPQVKTEKEDFIELCTPGVIKQEKLGPV
YCQANFSGANIIGNKMSAISVHGVSTSGGQMYHYDMNTATLSQQQDQKPIFNVIPPIPVS
SENWNRCQGSGDENLTSLGTLNFSGRSVFSNGYSSPGMRPDVSSPPSNSSTAVGPPPKLC
LVCSDEASGCHYGVLTCGSCKVFFKRAVEGRQHNYLCAGRNDCIIDKIRRKNCPACRYRK
CLQAGMNLEARKTKKKIKGIQQTTTGISQETPENSANKTIVPATLPQLTPTLVSLLEVIE
PEVLYAGYDSSLPDTTWRIMSALNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSW
MFLMAFALGWRSYKQASANLLCFAPDLIINEQRMSLPFMYDQCKHMLFVSSELQRLQVSY
EEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTK
LLDSMHDVVENLLNYCFQTFLDKTMRIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK
NT seq 2334 nt   +upstreamnt  +downstreamnt
atggattccaaagaatcattaacctcccccagtgaagaaatccccagcagtgtgcatggt
caggagagaggaaatgtgatggacttctataaaacccgaaggggaggagctactgtcaag
gtttctacgccttcaccctcactggctgctacttctcagtcagactccaagcagcaaaga
cttttggttgattttccaaaaggttcagtaagcaatgtgcagcagccagatctgtccaaa
gcagtttcactctccatgggattatatatgggagaaacagaaacaaaagtgatgggaaat
gacctgggattcccacagcagggccaaatcagcctttcctctggggaaacaaacttgcag
cttctggaagaaagcatcgcaaacctcaataggtcgaccagtgttccagagcaccccaag
atctcagcatctgttgctgtatctgctgccctcctagagaaagaactcccagaaactccc
tctgatgtatcttcggaacaacaaaatttaaagggccagactggcaccaacggtggcaat
gtgaagttgtgtactgcagaccaaagcacctttgatattttgcaggatttggagttttct
tctgcgtccccaggtagagagacaaatgagagcccttggagatcagacctgttgctagat
gaaaactgtttgctttctcctttggcagtcgaggatgatccattcctttcggaaggaaat
ttgaaggaggactgcaagcctctcattttaccggacactaaacctaaaattaaggataat
ggagatctgattttatcgagccccaagagtgtaccactgccccaagtgaaaactgaaaaa
gaagatttcatcgaactctgcacccctggagtaattaagcaagagaaactgggcccagtt
tactgtcaggcaaacttttccggagcaaatataatcggtaataaaatgtctgccatttct
gttcatggtgtgagtacctctggaggacagatgtaccattacgacatgaatacagcaacc
ctttctcaacagcaggatcagaagcccatttttaatgtcattccaccaattcctgttagt
tcagaaaattggaataggtgccaaggatctggagatgagaacttgacttccttgggaact
ttgaacttctctggccgatcagttttttccaatggctactcaagccctggaatgagaccc
gatgtcagttctcctccatctaactcctctacagcagtgggaccacctcccaaactctgc
ctggtatgctctgatgaagcttcaggatgtcactatggggtcttgacttgtggaagctgt
aaagtattcttcaaaagagctgtggaaggtaggcagcacaattacctttgcgctggaagg
aatgactgtatcattgataaaattcgaaggaaaaactgcccagcgtgccgctatcgaaaa
tgtcttcaagccggaatgaacctggaagctcgaaaaacgaagaaaaaaataaaaggaatt
cagcagaccactacaggaatctcacaagaaactcctgaaaattctgctaacaaaacaata
gttcctgcaacattaccacaactcacccctaccctggtgtcactgttggaagtcattgag
cctgaggtgttatatgcaggatacgatagctcgcttccagatacaacctggaggatcatg
agtgcactcaacatgttaggtgggcggcaagtgattgccgctgtgaagtgggcaaaggcg
ataccaggattcaggaacttgcacctggatgaccaaatgaccctactgcagtactcttgg
atgtttctcatggcatttgccctggggtggagatcatataaacaagcaagtgcaaatttg
ctgtgttttgctcctgatctgattattaatgagcagagaatgtctctccccttcatgtat
gaccaatgtaaacatatgctgtttgtttcctctgagttacagaggcttcaggtctcttat
gaagagtatctctgcatgaaaaccttactacttctctcttcagttcctaaggaaggtttg
aagagccaagagctatttgatgaaattagaatgacctacatcaaagagctaggaaaagcc
atagttaaaagggaaggaaactccagtcaaaactggcagcgtttttatcagctgacaaaa
ctcttggactccatgcatgatgtggttgaaaatcttcttaactattgcttccaaacattt
ttggataagaccatgaggattgagttcccagagatgttggctgaaatcatcaccaatcaa
ataccaaaatactcaaatggaaatatcaagaaacttctgtttcatcaaaaatga

DBGET integrated database retrieval system