KEGG   Tupaia chinensis (Chinese tree shrew): 102471296
Entry
102471296         CDS       T02978                                 

Gene name
KCNMA1
Definition
(RefSeq) potassium calcium-activated channel subfamily M alpha 1
  KO
K04936  potassium large conductance calcium-activated channel subfamily M alpha member 1
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04022  cGMP-PKG signaling pathway
tup04270  Vascular smooth muscle contraction
tup04911  Insulin secretion
tup04924  Renin secretion
tup04970  Salivary secretion
tup04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    102471296 (KCNMA1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102471296 (KCNMA1)
   04924 Renin secretion
    102471296 (KCNMA1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102471296 (KCNMA1)
  09154 Digestive system
   04970 Salivary secretion
    102471296 (KCNMA1)
   04972 Pancreatic secretion
    102471296 (KCNMA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:tup04040]
    102471296 (KCNMA1)
Ion channels [BR:tup04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   102471296 (KCNMA1)
SSDB
Motif
Pfam: BK_channel_a Ion_trans Ion_trans_2 TrkA_N Lig_chan
Other DBs
NCBI-GeneID: 102471296
NCBI-ProteinID: XP_006154955
LinkDB
Position
Un
AA seq 1232 aa
MSSNIHANHLSLDASSSSSSSSSSSSSSSSSVHEPKMDALIIPVTMEVPCDSRGQRMWWA
FLASSMVTFFGGLFIILLWRTLKYLWTVCCHCGGKTKEAQKINNGSSQADGTLKPVDEKE
EAVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSIGALVIYFIDSSNPIESCQNF
YKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVNSVVDFFTVPPVFVSVYLNRSWL
GLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIFISTWLTAAGFIHLVENSGDPWE
NFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYVPEIIE
LIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPN
LELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRV
ISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIAQSCLAQGLS
TMLANLFSMRSFIKIEEDTWQKYYLEGVSNEMYTEYLSSAFVGLSFPTVCELCFVKLKLL
MIAIEYKSANRESRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITDPKR
IKKCGCKRLIYFEDEQPSTLSPKKKQRNGGMRNSPNSSPKLMRHDPLLIPGNDQIDNMDS
NVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVVVCIFGDVSSALIGLRNLVMPL
RASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILPGTPLSRADLRAVNINLCDMCV
ILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQANSQGFTPPGMDRSSPDNSPV
HGILRQPSITTGVNIPIITELAKPGKLPLVSVNQEKNSGTHILMITELVNDTNVQFLDQD
DDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIA
EENALRGGYSTPQTLANRDRCRVAQLALLDGPFADLGDGGCYGDLFCKALKTYNMLCFGI
YRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDHNAGQSRASLSHSSHSSQ
SSSKKSSSVHSIPSTANRQNRPKSRESRDKQNATRMNRMGQAEKKWFTDEPDNAYPRNIQ
IKPMSTHMANQINQYKSTSSLIPPIREVEDEC
NT seq 3699 nt   +upstreamnt  +downstreamnt
atgagtagcaatatccacgcgaaccatctcagcctagacgcgtcctcctcctcttcctcc
tcttcttcctcctcctcttcctcctcgtcctcggtccacgagcccaagatggatgcgctc
atcatcccggtgaccatggaggtgccgtgcgacagccggggccaacgcatgtggtgggct
ttcctggcctcctctatggtgactttcttcgggggcctcttcatcatcttgctctggcgg
acgctcaagtacctgtggaccgtttgctgccactgcgggggcaagacgaaggaggcccag
aagattaacaatggctcaagccaggcggatggcactctcaagccagtggacgaaaaagag
gaggcggtggcagccgaggtcggctggatgacctctgtgaaagactgggcaggggtgatg
atatccgcccagacgctgactggcagagtcctggttgtcttagtctttgctctcagcatt
ggtgcacttgtaatatacttcatagactcgtcaaacccaatagaatcctgccagaatttc
tacaaagatttcacattacagatcgacatggctttcaacgtgttcttccttctctacttt
ggcttgcggtttattgcagccaacgataagctgtggttctggctggaagtgaactctgta
gtagatttcttcacggttcccccagtgtttgtgtctgtgtacttaaacagaagttggctt
ggtttgagatttttaagagccctcaggctgatacagttttcagaaattttgcaattcctg
aatatccttaaaacaagtaattccatcaaactggtgaatctgctgtccatatttatcagc
acatggctaacagcagccgggttcatccatttggtggagaattcaggggacccatgggaa
aattttcagaacaaccaggcgcttacctattgggaatgtgtctatttactcatggtcaca
atgtccaccgttggttatggggatgtttatgcgaaaaccacccttgggcgcctcttcatg
gtcttcttcatcctcgggggcctggccatgtttgccagctacgtccctgaaatcatagag
ttaataggaaaccgcaagaaatacgggggctcctatagtgcggttagtggaagaaagcat
attgtggtgtgtggacacatcactctggagagcgtctccaacttcctgaaggactttctg
cacaaggaccgggatgatgtcaatgtggagatcgtctttcttcacaacatttcccctaac
ctggagcttgaagctctgttcaaacgacattttactcaggtggaattttatcagggttcg
gtcctcaatccacatgatcttgcaagagtcaagatagagtcagcagatgcgtgcctaatc
cttgccaacaaatattgcgccgacccagatgctgaagatgcctccaacatcatgagagta
atctccataaagaactaccacccgaagatcagaatcatcactcagatgttgcagtatcac
aacaaggcccatctgctaaacatcccgagctggaattggaaagagggtgatgatgcaatc
tgcctcgcagagctgaagttgggtttcatagcccagagctgcctggctcaaggcctctcc
accatgcttgccaacctcttctccatgaggtcattcataaagattgaggaagacacgtgg
cagaaatactacttggaaggagtctcaaatgaaatgtacacagaatatctctccagtgcc
ttcgtgggtttgtccttccctactgtttgtgagctgtgttttgtgaagctcaagctccta
atgatagccattgagtacaagtccgccaaccgagagagccgtatattaattaatcctgga
aaccatcttaagatccaagaaggtactttaggatttttcatcgcaagtgatgccaaagaa
gttaaaagggcatttttttactgcaaggcctgtcatgatgacatcacagatcccaaaaga
ataaaaaaatgcggctgcaaacggctgatatattttgaagatgagcagccgtcaacgcta
tcaccaaaaaaaaagcaacggaatggaggcatgcggaactcacccaactcctcacctaag
ctgatgaggcacgaccccttgttaattcccggcaatgatcagattgacaacatggactcc
aatgtgaagaagtatgactctactgggatgtttcactggtgcgcacctaaggagatagag
aaagttatcctgactcgaagtgaagccgccatgactgtcctgagtggccacgttgtggtc
tgcatctttggtgatgtcagctcagccctgattggcctccggaacctagtgatgccactc
cgtgccagcaactttcattaccatgagctcaagcacattgtgtttgtaggctccattgag
tacctcaagagggaatgggagacgcttcataacttccccaaagtgtccatattgcctggt
acgccattaagtcgggctgatttaagggctgtcaacatcaacctctgtgacatgtgcgtt
atcctgtcagccaatcagaataatattgatgatacttcgctgcaggacaaggaatgcatc
ttggcgtcactcaacatcaaatctatgcagtttgatgacagcatcggggtcttgcaggct
aattcccaaggattcacacctccaggaatggacagatcctctccagataacagcccagta
catgggatattacgccagccatctatcacgactggggtcaatatccccatcatcactgaa
cttgctaaaccaggcaagttgcctttggtatcagtcaatcaggaaaaaaacagtgggacg
cacattctaatgataactgaactggtgaatgatactaatgttcagtttttggaccaagac
gatgacgatgaccccgacacagaactgtacctcacgcagccctttgcgtgtgggacagca
tttgccgtcagcgtcctggactcgctcatgagtgcgacatacttcaatgacaatatcctc
accctgattcggaccttggtgaccggaggagccacgccagagcttgaggctctgattgct
gaggagaacgcactgcgagggggctacagcaccccccagacactggccaacagggaccgc
tgccgggtggcccagctagcactgctggatgggccctttgcagacttaggggatggtggt
tgttatggtgacctgttctgcaaagctctgaaaacgtataatatgctttgttttggaatt
taccgactgagagatgcccaccttagcacccccagtcagtgcacaaagaggtatgtcatc
accaaccccccctacgaatttgagcttgtgccgacggacctgatcttctgcttaatgcag
tttgaccacaacgccggccagtcccgggccagcctgtcccattcttcccactcgtcgcag
tcctccagcaagaagagttcctctgttcactccatcccatccacagcaaaccgacagaac
cggcccaagtccagggagtccagggacaaacagaatgcaacaaggatgaatagaatgggc
caagcagaaaagaaatggtttacagatgaaccggataatgcctatcccagaaacattcaa
atcaagcccatgagtacccacatggctaaccagatcaaccaatataaatccacaagcagc
ttgattccaccaatcagagaagtcgaagatgaatgttga

DBGET integrated database retrieval system