KEGG   Tupaia chinensis (Chinese tree shrew): 102471595
Entry
102471595         CDS       T02978                                 

Gene name
SLC3A2
Definition
(RefSeq) solute carrier family 3 member 2
  KO
K06519  solute carrier family 3, member 2
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04150  mTOR signaling pathway
tup04216  Ferroptosis
tup04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    102471595 (SLC3A2)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    102471595 (SLC3A2)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    102471595 (SLC3A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tup02000]
    102471595 (SLC3A2)
   04147 Exosome [BR:tup04147]
    102471595 (SLC3A2)
   04090 CD molecules [BR:tup04090]
    102471595 (SLC3A2)
Transporters [BR:tup02000]
 Solute carrier family (SLC)
  SLC3: Heavy subunits of the heteromeric amino acid transporters
   102471595 (SLC3A2)
Exosome [BR:tup04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102471595 (SLC3A2)
CD molecules [BR:tup04090]
 Proteins
  102471595 (SLC3A2)
SSDB
Motif
Pfam: SLC3A2_N Alpha-amylase DUF3459 Malt_amylase_C Cellulase
Other DBs
NCBI-GeneID: 102471595
NCBI-ProteinID: XP_014446412
LinkDB
Position
Un
AA seq 570 aa
MDPEPSEPSTDVVSVPNQPPSPRSGPGVQGLGAGGDSGTMSQDTEVDMKEVELNELEPEK
QPMNAASGAAVAVAGGAEKNGLVKIKVAEDEAEAAAAAKFTGLSKEELLKVAGSPGWVRT
RWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPVQRWWHKGALYRIGDLQAFVGSDEGNL
AGLKGHLDYLSTLKVKGLVLGPIHKNPKDDIAGTNLEEIDPTLGSTEDFDNLLQSAKKKS
IRVILDLTPNYRGQNSWFLPTDVTTVATKVKDALGFWLQAGVDGFQVRDVENLKDAFSLL
ADWQNITSSFSEDRLFIAGTNSPDLQQIMSLLGSTKDLLLTNSYLSTPGFTGEHTKFLVT
QYLNSTGSHWRSWSLSQAGLLSSFIPAQLLRLYQLLLFTLPGTPIFSYGDEIGLQVAAVS
GQPMEAPVMLWDESSFSNVSGFLSVNRTVKGQSEDPDSFLSLFRRLSDQRGKERSLLHGD
FHALSSEPALFSYVRHWDQNERFLVVLNFGNVGVSTSLATSSLPASTSLPASADVLLSTQ
PGRQEGTSLTLERLHLEPYEGLLLRFPYVA
NT seq 1713 nt   +upstreamnt  +downstreamnt
atggatcccgaaccttctgaaccctcgaccgacgtcgtctcggttccgaaccagccgccc
agcccgcgttctgggcctggtgtccagggtctcggcgctgggggcgactcaggtaccatg
agccaggatactgaggtggatatgaaggaggtggagctgaatgagctagaaccggagaag
caaccgatgaacgcggcgtcgggggcagcggtggctgtggcgggtggcgccgagaagaat
ggtctggtgaagatcaaggtggcggaagacgaggcagaggcggcggcagcggctaagttc
accggcttgtccaaggaggagctgcttaaggtggcgggcagccccggctgggtgcgcacc
cggtgggcgctgctgctcctcttctggctcggctggctcggcatgctggcgggtgcggtg
gtcatcatcgtgcgagctccgcgctgtcgcgagctgccggtgcagaggtggtggcacaag
ggcgccctctaccgcatcggcgaccttcaggccttcgtgggcagcgacgagggcaaccta
gcgggtctgaagggtcatcttgattacctgagcactctaaaggtgaagggccttgtcctg
ggcccaattcacaagaacccgaaggatgatattgccgggaccaacttggaagagatcgac
cccactcttggctccacggaagattttgacaatctcctgcaatcagcaaagaaaaagagt
atccgtgtcattctggacctcactcctaactatcgtggccagaactcgtggttcctgccc
actgacgttaccactgtggccaccaaggtgaaggatgctctgggattttggttgcaggct
ggtgtagatgggttccaagtccgggatgtggagaatctgaaggatgcattctcactcttg
gctgactggcagaacatcaccagcagcttcagtgaagataggctcttcatagcaggaacc
aactcccctgacctgcagcagatcatgagcttactgggatccaccaaggacctgctattg
accaattcatacctgtcaactcctggtttcactggggagcacacaaaattccttgtcacc
cagtatttgaattccactggcagtcactggcgcagctggagtttgtctcaggcaggtctc
ctgagttccttcataccagctcaacttcttcgactctaccaactgctgctcttcaccctg
ccggggacccccattttcagctatggggatgagattggcctgcaggtggctgctgtttct
ggccagcctatggaggcccctgtcatgctgtgggatgaatccagcttctcaaatgtctca
ggattcctaagtgtcaacaggactgtgaagggccagagcgaagatcctgattccttcctt
tccctgttccggcggctgagtgaccaacggggtaaagagcgctccctgctgcatggggac
ttccacgcactgtcttctgagcctgcactcttttcttatgtccgccactgggaccagaac
gagcgtttcctggtggtgctcaactttgggaatgtgggtgtctctaccagcctggcaacc
tccagtctgcctgccagcaccagtctgcctgccagtgccgatgtgctgctcagcacccag
ccaggccgtcaggagggcacctcccttacgctggaacgcctccacctggagccctatgag
gggctgctgctccgcttcccctatgtggcctga

DBGET integrated database retrieval system