KEGG   Tupaia chinensis (Chinese tree shrew): 102471693
Entry
102471693         CDS       T02978                                 

Gene name
PTCH1
Definition
(RefSeq) patched 1
  KO
K06225  patched 1
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04024  cAMP signaling pathway
tup04340  Hedgehog signaling pathway
tup04360  Axon guidance
tup05200  Pathways in cancer
tup05205  Proteoglycans in cancer
tup05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102471693 (PTCH1)
   04024 cAMP signaling pathway
    102471693 (PTCH1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    102471693 (PTCH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102471693 (PTCH1)
   05205 Proteoglycans in cancer
    102471693 (PTCH1)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    102471693 (PTCH1)
SSDB
Motif
Pfam: Patched Sterol-sensing
Other DBs
NCBI-GeneID: 102471693
NCBI-ProteinID: XP_006167882
LinkDB
Position
Un
AA seq 1244 aa
MFNPQLMIQTPKEEDANVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHLCYKSGELIT
ETGYMDQIIEYLYPCLIITPLDCFWEGAKLQSGTAYLLGKPPLRWTNFDPLEFLEELKKI
NYQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPATAPNKNSTKPLDMALVLNGGCHGLS
RKYMHWQEELIVGGTVKNSTGKLVSAHALQTMFQLMTPKQMYEHFKGYEYVSHINWNEDK
AAAILEAWQRTYVEVVHQSVAQNSTQKVLSFTTTTLDDILKSFSDVSVIRVASGYLLMVL
PFLALGVGVDDVFLLAHAFSETGQNKRIPFEDRTGECLKRTGASVALTSISNVTAFFMAA
LIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCFTSPCVSRVI
QVEPQAYTETHDNTRYSPPPPYSSHSFAHETQITMQSTVQLRTEYDPHTHVYYTTAEPRS
EISVQPVTVTQDTLSCQSPESTSSTRDLLSQFSDSSLHCLEPPCTKWTLSSFAEKHYAPF
LLKPKAKVVVIFLFLGLLGVSLFGTTRVRDGLDLTDIVPRETREYDFIAAQFKYFSFYNM
YIVTQKADYPNIQHLLYDLHKSFSNVKYVMLEENKQLPKMWLHYFRDWLQGLQDAFDSDW
ETGKIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYIYL
TAWVSNDPVAYAASQANIRPHRPEWVHDKADYMPETRLRIPAAEPIEYAQFPFYLNGLRD
TSDFVEAIEKVRTICNNYTSLGLSSYPNGYPFLFTAPRHWLLLSISVVLACTFLVCAVFL
LNPWTAGIIVMVLALMTVELFGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFLTA
IGDKNRRAVLALEHMFAPVLDGAVSTLLGVLMLAGSEFDFIVRYFFAVLAILTILGVLNG
LVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVRFAVPPGHTNAGSDSSDSEYSS
QTTVSGISEELQHYEAQRGPGDSAHQVIVEATENPVFARSTVVHPESRHHAPSNPRQQPH
LDSGFLPSGRQGQQPRRELPKEGLRPPPYKPRRDAFEISTEGLSGPSNSRERSAPRGARS
HNPRNPAATATSSSVPGYCQPITTVTASASVTVAVHPPPVPGPGRIPRGGLCPGYEGYPE
TDHGLFEDPHVPFHVRCERRNSKVEIIELQDVECEERLRGSSSN
NT seq 3735 nt   +upstreamnt  +downstreamnt
atgtttaatcctcaactcatgatacagactccgaaagaagaagacgctaatgtcctgacc
actgaagccctcctccaacatttggactcggcgctccaggccagccgcgtgcatgtatac
atgtacaacaggcaatggaaattggaacatttgtgttacaaatcaggagaacttatcaca
gaaacaggttatatggatcagataatagaatatctttacccttgtctaattattacacct
ttggactgcttctgggaaggagcgaagttgcaatctgggaccgcatacctcctaggtaaa
cctcctttgcggtggacaaactttgaccctttggaattcctagaagagttaaagaaaata
aactatcaagtggacagctgggaggaaatgctgaataaggctgaagttggtcatggttac
atggatcgtccctgcctcaacccggctgatccagactgccctgccacggcccccaacaaa
aattcaaccaaacctcttgatatggcccttgttctgaatggtggatgtcatggattatcc
agaaagtatatgcactggcaggaggaactgattgtgggtggcacagtgaagaacagcact
ggaaaacttgtcagtgcccacgccctgcagaccatgttccagttaatgactcccaagcag
atgtacgagcacttcaaggggtacgagtatgtctcgcatatcaactggaacgaggacaaa
gcagcggccatcttggaggcgtggcagaggacctacgtggaggtggttcatcaaagtgtt
gcccagaactctacccagaaggtgctttccttcaccacgacaaccctggacgacatcctg
aaatccttctctgatgtcagcgtcatccgggtggccagcggctacttactgatggttttg
ccatttcttgctctcggcgttggtgtggatgatgttttccttctggcgcacgcatttagt
gagacaggacagaataaaagaattcctttcgaggacaggactggggagtgcctcaagcgt
actggagccagcgtggccctcacgtccatcagcaacgtcacggccttcttcatggcagcg
ctcatcccaattcctgctctgcgggccttctccctccaggcagcagtagtagtggtgttc
aattttgccatggttctgctcatttttcctgcaattctcagcatggatttataccgacgt
gaggataggagactggatatcttctgctgttttacgagcccctgtgtcagcagagtgatc
caggtggagccacaggcctacacggagacacacgacaatacccgctacagcccccccccc
ccctacagcagccacagttttgcccatgaaacgcagatcaccatgcagtccactgtccag
ctgcgcacggagtacgacccccacacccacgtgtactacaccacagccgagccacgctcc
gagatctccgtgcagcctgtcaccgtgacccaggacaccctcagctgccagagccccgag
agcacaagctccaccagggacctgctctcccagttctccgactccagcctccactgcctc
gagcccccctgtaccaagtggacactttcctcttttgctgagaagcactatgcgcctttc
ctcttaaaaccaaaagccaaggtcgtggtgatcttcctcttcttgggcttgttgggggtc
agcctttttgggaccacccgggtgagagacgggctggaccttaccgacatcgtacctcgg
gaaaccagagagtatgactttattgctgcacagttcaaatacttctctttctataacatg
tacatagtcacccagaaagcagactacccaaatatccagcacttactctatgaccttcac
aagagtttcagtaacgtgaagtatgtcatgttggaagaaaacaaacagcttcccaaaatg
tggctgcactatttccgagactggctccaaggacttcaggatgcatttgatagtgactgg
gaaactgggaaaatcatgccaaacaattacaaaaatggatcggatgatggggtcctggcc
tacaaacttctggtgcaaactggcagccgcgacaagcccatcgacatcagccagttgact
aaacagcgtctggtggacgcagatggcatcattaatcccagcgccttctacatctacctg
accgcctgggtcagcaacgatcctgtcgcctacgccgcctcccaggccaacatccggccc
caccgacccgagtgggtacatgacaaagctgactacatgccagaaaccaggctgcggatc
ccagcagcagagcccattgaatacgctcagttccctttctacctcaatggcttgcgagac
acctcagactttgtggaagcgatcgagaaggtcagaaccatctgcaacaactacacgagt
ctgggcctctccagctaccccaacggctaccccttcctcttcaccgccccccgccactgg
ctgctgctctccatcagcgtggtcttggcctgcacgttcctcgtgtgcgccgtcttcctc
ctgaacccctggacggctgggatcattgtgatggtcctggcattgatgacggtcgagctc
ttcggcatgatgggcctcattggaatcaagctcagcgccgtgcccgtggtcatcctgatc
gcttctgtcggcatcggggtggaattcaccgtccacgttgctttggcctttctgacagcc
atcggcgataagaaccgcagagcggtgctggccctcgagcacatgttcgcacctgtcctg
gacggcgccgtgtccacgctgctgggggtgctgatgctggcagggtctgagtttgacttc
atcgtcaggtacttctttgctgtcctggccatactgaccatcctgggtgttctcaacggg
ctggttttgcttccggtcctcttgtctttctttggaccctaccctgaggtatctccagcc
aatggcctgaaccgactgcccactccctcccctgagccaccccccagcgttgtccggttt
gctgtgccccccggtcacacgaacgccgggtccgattcttctgactcggagtacagttct
cagacaacggtgtcaggcatcagcgaggagcttcagcactatgaggctcagcgtggccca
ggggactctgcccaccaggtgatcgtggaagccacggaaaaccctgtcttcgcccgttcc
accgtggttcatcctgaatcaaggcatcacgcaccctcgaatcctcgacagcagccccac
ctggactcagggtttctgccctccgggcggcaaggccaacagccccgcagggaactcccc
aaagaaggcttgcggccgcctccctacaaaccgcgcagagacgctttcgaaatttctact
gaagggctttctggccctagcaatagtcgggagcgctcagccccccgtggggctcgttct
cacaaccctcggaacccagcagccactgccacgagcagctctgtgcctggctattgccag
cccatcaccactgtgacagcttccgcttccgtgactgttgccgtgcatcctccacctgtc
cccgggcctggacggatcccccgagggggactctgcccaggctacgagggctaccctgag
actgaccacgggctgtttgaggacccccacgtgccttttcacgtccggtgcgagaggagg
aattcaaaggtggagatcatagagctgcaggacgtggagtgcgaggagaggctgcgggga
agcagctctaactga

KEGG   Tupaia chinensis (Chinese tree shrew): 102502271
Entry
102502271         CDS       T02978                                 

Gene name
PTCH2
Definition
(RefSeq) patched 2
  KO
K11101  patched 2
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04340  Hedgehog signaling pathway
tup05200  Pathways in cancer
tup05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102502271 (PTCH2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102502271 (PTCH2)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    102502271 (PTCH2)
SSDB
Motif
Pfam: Patched Sterol-sensing MMPL
Other DBs
NCBI-GeneID: 102502271
NCBI-ProteinID: XP_014445371
LinkDB
Position
Un
AA seq 1207 aa
MARSPPLGDLPPGYTLPALSAAPQILAGTLKAPLWLRAYFQGLLFSLGCGIQRHCGKALF
LGLLAFGALALGLRVAVIETDLEQLWVEVGSRVSQELHYTKEKLGEEAAYTSQMLIQTAR
QQGENILTPEALSLHLQAALTASKVQVSLYGKSWDLNKICYKSGVPLIENGMIERMIEKL
FPCVILTPLDCFWEGAKLQGGSAYLPGRPDIQWTNLDPQQLLEELGPFATLEGFRELLAK
AQVGQAYVGRPCLHPDDLHCPPSAPNRHSRQAPNVAQELSGGCHGFSHKFMHWQEELLLG
GIARDSQGQLLRAEALQSTFLLMSPRQLYEHFRGDYQTHDIGWSEEQAGTVLQAWQRRFV
QLAQEALPENASQQVHAFSSTTLDDILHAFSQVSAARVAGGYLLMLAYACVTMLRWDCAQ
SQGAVGLAGVLLVALAVASGLGLCALLGITFNAATTQVLPFLALGIGVDDIFLLAHAFTE
APPGTPLQERTGECLQRTGTSVTLTSINNMVAFFMAALVPIPALRAFSLQAAIVVGCNFA
AVMLVFPAVLSLDLRRRHCQRLDVLCCFSSPCSARVIQLLPQELGDGTVPVGITHLTATV
QAFTHCEASTQHVVTILPPQTHLVAPASDPPGSELFSPGGSTRDLLGQEESTRQKTACKS
PPCAHWNLAHFARYQFAPLLLQSHIKVMVLVLFGALVGLSLYGATLVQDGLALTDVVPQG
TKEHAFLSAQLRYFSLYEVALVTQGGFDYAYSQRALFDLHQRFSSLKAVLPPPATQAPRT
WLHYYRDWLQGIQAAFDQDWASGRITHHSYRNGSEDGALAYKLLIQTGDAQEPLDFSQLT
SRKLVDTEGLIPPELFYVGLTMWVSSDPMGLAASQANFYPPPPEWLHDKYDATGENLRIP
AAQPLEFAQFPFLLHGLQKTADFVEAIEGARAACAEASQAGVHAYPSGSPFLFWEQYLGL
RRCFLLAICILLVCTFLVCALLLLSPWTAGLVVLVLTMMTVELFGIMGFLGIKLSAIPVV
ILVASVGIGVEFTVHVALGFLTTQGSRNLRAARALEHTFAPVTDGAVSTLLGLLMLAGSN
FDFIVRYFFVVLTVLTLLGLLHGLVLLPVLLSILGPPPEEVQLYKESPEVLSPPAARRGG
LRWGVAPTPPQSFARVTTSMTVALSPPPLPGAYVHSASDEPTWSSAITLAANGSDNLSAR
GPCPATA
NT seq 3624 nt   +upstreamnt  +downstreamnt
atggctcggtcgccgcccctcggggatctgcccccgggctacacactcccagctctatcc
gcagcaccccagatcctagccgggaccttgaaggctccgctctggctccgcgcttacttt
cagggcctgctcttctctctgggctgtgggatccagagacactgtggcaaagcactcttc
ctgggcctgttagcctttggggccttggccctgggtctccgcgtggcagttattgagaca
gacctggaacagctctgggtagaagtgggcagccgggtgagccaggagctgcattacacc
aaggagaagctgggggaggaagctgcgtacacctcccagatgctgatacagactgcacgc
cagcagggggagaacatcctcacacctgaggcacttagcctccacctccaggcagccctc
actgccagcaaagtgcaagtatcgctctacggaaagtcctgggatttgaacaaaatctgc
tacaagtcaggagttccccttattgaaaatggaatgattgagcggatgattgagaagctg
tttccgtgtgtgatcctcactcccctcgactgcttctgggagggagccaaactccaaggg
ggctctgcctacttgccgggtcgcccagatatccagtggaccaacctggacccacagcag
ctgctagaggagctgggcccctttgccacccttgagggcttccgggagctactagccaag
gcacaggtgggccaggcctacgtgggacgcccctgtctgcaccccgacgacctgcattgc
ccacctagtgcccccaatcgtcacagcaggcaggctcccaatgtggctcaggaactgagt
gggggctgccatggcttctcccacaagtttatgcactggcaggaggaattgttgctggga
ggcatagccagagactcccaaggacagctgctgagggcagaggccctgcagagcaccttc
ctgctaatgagtccccgccagctgtatgagcacttccggggtgactaccagacacatgac
attggctggagcgaggagcaggctggcacggtgctgcaggcctggcagcgacgcttcgtg
cagctggctcaggaggccctgcctgagaacgcgtcccagcaagtccacgccttctcctcc
accaccctggatgacatcctgcacgccttctctcaagtcagtgctgcccgagtggcggga
ggctacctgctcatgctagcctacgcctgcgtgacgatgctgcggtgggactgcgcccag
tcacagggcgctgtgggccttgctggggtgctgttggtggccctggcagtggcctcaggc
cttgggctctgtgccctgcttggcatcaccttcaatgctgccactactcaggtgctgccc
ttcttggcgctgggaattggcgtggatgacatattcctgttggcacatgccttcacagag
gctccccctggcacccctctgcaggagcgcacgggggagtgtctgcagcgcacaggcacc
agtgtcacactcacctccatcaacaacatggtcgccttcttcatggccgccctcgttccc
atccctgcactgagggccttctccttgcaggcggccatagtggttggctgcaacttcgca
gctgtcatgcttgtcttcccagctgtcctcagcctggatctgcgccggcgccactgccag
cgcctcgatgttctctgctgcttctccagcccctgctctgcccgagtgattcagcttctg
ccccaggagctgggggatgggacagtaccagtgggcatcacccacctgaccgccacggtt
caagcctttacccactgtgaagccagcacccagcatgtggtcaccatcctacctccccaa
acccacctggttgccccggcctctgacccaccgggctctgagctcttcagccctggaggg
tccacacgagaccttctaggccaggaggaaagcaccaggcagaagacagcctgcaagtct
ccaccctgtgctcactggaatcttgcccatttcgcccgctaccagtttgcacccctgctg
ctccaatcccatatcaaggtcatggtgctggtgctctttggggctcttgtgggcctaagc
ctctatggagccaccttggtacaggacgggctggccctgaccgatgtggtgcctcagggc
accaaggagcatgccttcctgagtgcccagctcaggtacttctccttgtatgaggtggcc
ctggtgacccagggtggctttgactacgcctactcccaacgcgccctctttgatctgcac
cagcgcttcagttccctcaaggccgtgctgcccccgcctgccacccaggcaccccgcacc
tggctgcactattaccgcgactggctacagggaatccaggctgcctttgaccaagactgg
gcttctgggcgcatcacccaccattcgtaccgcaatggttctgaggacggggcccttgcc
tacaagctgctcatccagactggggatgctcaggaacccttggatttcagccagctgacc
tcaaggaagctagtggacacagagggactgattccacccgagctcttctacgtggggctg
accatgtgggtgagcagcgaccctatgggtctggcagcctcacaggctaacttctacccg
ccgcctcctgagtggttgcacgacaagtacgacgccaccggggagaacctgcgcatccca
gcggcccagcctctggagtttgcccagttccccttcctgctgcacggcctccagaagaca
gcagactttgtggaggccatcgagggggcccgggcagcgtgcgcagaggccagccaggcc
ggggtgcatgcctaccccagtggctcccccttcctcttctgggagcagtacctgggcctg
cggcgctgcttcctgctggccatctgcatcctgctcgtgtgcacgttcctcgtctgtgcc
ctgctgctgctcagtccctggacggctggcctcgtggtgctggtcctgacgatgatgacc
gtggagctcttcggtatcatggggttcctgggcatcaagctgagcgccattcctgtggtg
atcctcgtggcttcagtaggcattggtgtcgagttcacagtccacgtggctctgggcttc
ctgaccacccaggggagccggaacttgcgggctgcccgtgccctcgagcacacgtttgcc
cccgtgaccgacggagctgtctccacgttgctgggtctgctcatgctcgctggttccaac
tttgacttcatagtcaggtacttctttgtggtgctgacagtgctcacactcctgggcctc
ctccatggactcgtgctgttgcctgtgctgctgtccatcctgggacccccgccagaggag
gtacagttgtacaaggagagcccagaggtcctgagccccccggctgcacggagaggtggg
ctcaggtggggcgtggctcccaccccgccccagagcttcgccagagtgactacctccatg
acggtggccctctccccacccccgctgcctggtgcctatgtccactcagcctccgatgag
cccacctggtcctctgccatcaccctagctgccaacggctctgacaacctcagtgctaga
ggaccatgtccagccactgcgtga

DBGET integrated database retrieval system