KEGG   Tupaia chinensis (Chinese tree shrew): 102471776
Entry
102471776         CDS       T02978                                 

Gene name
BAX
Definition
(RefSeq) BCL2 associated X, apoptosis regulator
  KO
K02159  apoptosis regulator BAX
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01521  EGFR tyrosine kinase inhibitor resistance
tup01522  Endocrine resistance
tup01524  Platinum drug resistance
tup04071  Sphingolipid signaling pathway
tup04115  p53 signaling pathway
tup04141  Protein processing in endoplasmic reticulum
tup04210  Apoptosis
tup04211  Longevity regulating pathway
tup04215  Apoptosis - multiple species
tup04217  Necroptosis
tup04722  Neurotrophin signaling pathway
tup04932  Non-alcoholic fatty liver disease
tup04933  AGE-RAGE signaling pathway in diabetic complications
tup05012  Parkinson disease
tup05014  Amyotrophic lateral sclerosis
tup05016  Huntington disease
tup05020  Prion disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05132  Salmonella infection
tup05152  Tuberculosis
tup05160  Hepatitis C
tup05161  Hepatitis B
tup05162  Measles
tup05163  Human cytomegalovirus infection
tup05164  Influenza A
tup05165  Human papillomavirus infection
tup05166  Human T-cell leukemia virus 1 infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05168  Herpes simplex virus 1 infection
tup05169  Epstein-Barr virus infection
tup05170  Human immunodeficiency virus 1 infection
tup05200  Pathways in cancer
tup05202  Transcriptional misregulation in cancer
tup05203  Viral carcinogenesis
tup05210  Colorectal cancer
tup05212  Pancreatic cancer
tup05213  Endometrial cancer
tup05214  Glioma
tup05216  Thyroid cancer
tup05217  Basal cell carcinoma
tup05218  Melanoma
tup05220  Chronic myeloid leukemia
tup05222  Small cell lung cancer
tup05223  Non-small cell lung cancer
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102471776 (BAX)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    102471776 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102471776 (BAX)
   04215 Apoptosis - multiple species
    102471776 (BAX)
   04217 Necroptosis
    102471776 (BAX)
   04115 p53 signaling pathway
    102471776 (BAX)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102471776 (BAX)
  09149 Aging
   04211 Longevity regulating pathway
    102471776 (BAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102471776 (BAX)
   05202 Transcriptional misregulation in cancer
    102471776 (BAX)
   05203 Viral carcinogenesis
    102471776 (BAX)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102471776 (BAX)
   05212 Pancreatic cancer
    102471776 (BAX)
   05225 Hepatocellular carcinoma
    102471776 (BAX)
   05226 Gastric cancer
    102471776 (BAX)
   05214 Glioma
    102471776 (BAX)
   05216 Thyroid cancer
    102471776 (BAX)
   05220 Chronic myeloid leukemia
    102471776 (BAX)
   05217 Basal cell carcinoma
    102471776 (BAX)
   05218 Melanoma
    102471776 (BAX)
   05213 Endometrial cancer
    102471776 (BAX)
   05224 Breast cancer
    102471776 (BAX)
   05222 Small cell lung cancer
    102471776 (BAX)
   05223 Non-small cell lung cancer
    102471776 (BAX)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102471776 (BAX)
   05014 Amyotrophic lateral sclerosis
    102471776 (BAX)
   05016 Huntington disease
    102471776 (BAX)
   05020 Prion disease
    102471776 (BAX)
   05022 Pathways of neurodegeneration - multiple diseases
    102471776 (BAX)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102471776 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102471776 (BAX)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102471776 (BAX)
   05152 Tuberculosis
    102471776 (BAX)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102471776 (BAX)
   05170 Human immunodeficiency virus 1 infection
    102471776 (BAX)
   05161 Hepatitis B
    102471776 (BAX)
   05160 Hepatitis C
    102471776 (BAX)
   05164 Influenza A
    102471776 (BAX)
   05162 Measles
    102471776 (BAX)
   05168 Herpes simplex virus 1 infection
    102471776 (BAX)
   05163 Human cytomegalovirus infection
    102471776 (BAX)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102471776 (BAX)
   05169 Epstein-Barr virus infection
    102471776 (BAX)
   05165 Human papillomavirus infection
    102471776 (BAX)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102471776 (BAX)
   01524 Platinum drug resistance
    102471776 (BAX)
   01522 Endocrine resistance
    102471776 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:tup03029]
    102471776 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tup02000]
    102471776 (BAX)
Mitochondrial biogenesis [BR:tup03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    102471776 (BAX)
Transporters [BR:tup02000]
 Other transporters
  Pores ion channels [TC:1]
   102471776 (BAX)
SSDB
Motif
Pfam: Bcl-2 CF222
Other DBs
NCBI-GeneID: 102471776
NCBI-ProteinID: XP_014447767
UniProt: L9JDV2
LinkDB
Position
Un
AA seq 173 aa
MKTGALLLQGFIQDRAGRMGGETPELALEQAPQDASTKKLSECLKRIGDELDSNMELQRM
IAAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGW
TLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
NT seq 522 nt   +upstreamnt  +downstreamnt
atgaagacaggggcccttttgcttcagggtttcatccaggaccgtgctgggcggatgggt
ggggagacgcctgagctggccctggaacaggcaccccaggacgcctccaccaagaagctg
agcgagtgtctcaagcgcatcggggacgagctcgacagtaacatggaattgcagaggatg
attgccgctgtggacacggactctccccgggaggtctttttccgagtggcagctgagatg
ttttctgacggcaacttcaactggggccgagttgtcgcacttttctactttgccagcaaa
ctggtgctcaaggccctgtgcactaaggtgcccgagctcatcagaaccatcatgggctgg
acgctggacttcctccgggagcggctgctgggctggattcaagaccagggtggttgggat
ggcctcctgtcctactttgggacccccacgtggcagacagtgaccatcttcgtggccgga
gtgctcaccgcctcactcaccatctggaagaagatgggctga

DBGET integrated database retrieval system