KEGG   Tupaia chinensis (Chinese tree shrew): 102471806Help
Entry
102471806         CDS       T02978                                 

Gene name
JAK1
Definition
(RefSeq) Janus kinase 1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01521  EGFR tyrosine kinase inhibitor resistance
tup04151  PI3K-Akt signaling pathway
tup04217  Necroptosis
tup04380  Osteoclast differentiation
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04621  NOD-like receptor signaling pathway
tup04630  Jak-STAT signaling pathway
tup04658  Th1 and Th2 cell differentiation
tup04659  Th17 cell differentiation
tup05140  Leishmaniasis
tup05145  Toxoplasmosis
tup05152  Tuberculosis
tup05160  Hepatitis C
tup05161  Hepatitis B
tup05162  Measles
tup05163  Human cytomegalovirus infection
tup05164  Influenza A
tup05165  Human papillomavirus infection
tup05166  Human T-cell leukemia virus 1 infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05168  Herpes simplex virus 1 infection
tup05169  Epstein-Barr virus infection
tup05200  Pathways in cancer
tup05203  Viral carcinogenesis
tup05212  Pancreatic cancer
tup05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    102471806 (JAK1)
   04151 PI3K-Akt signaling pathway
    102471806 (JAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102471806 (JAK1)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102471806 (JAK1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102471806 (JAK1)
   04658 Th1 and Th2 cell differentiation
    102471806 (JAK1)
   04659 Th17 cell differentiation
    102471806 (JAK1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102471806 (JAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102471806 (JAK1)
   05203 Viral carcinogenesis
    102471806 (JAK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102471806 (JAK1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102471806 (JAK1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102471806 (JAK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102471806 (JAK1)
   05162 Measles
    102471806 (JAK1)
   05164 Influenza A
    102471806 (JAK1)
   05161 Hepatitis B
    102471806 (JAK1)
   05160 Hepatitis C
    102471806 (JAK1)
   05168 Herpes simplex virus 1 infection
    102471806 (JAK1)
   05163 Human cytomegalovirus infection
    102471806 (JAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102471806 (JAK1)
   05169 Epstein-Barr virus infection
    102471806 (JAK1)
   05165 Human papillomavirus infection
    102471806 (JAK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102471806 (JAK1)
   05140 Leishmaniasis
    102471806 (JAK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102471806 (JAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tup01001]
    102471806 (JAK1)
Enzymes [BR:tup01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102471806 (JAK1)
Protein kinases [BR:tup01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   102471806 (JAK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase FERM_F2 Jak1_Phl FERM_F1 SH2 RIO1 FERM_M
Motif
Other DBs
NCBI-GeneID: 102471806
NCBI-ProteinID: XP_006147597
LinkDB All DBs
Position
Un
AA seq 1152 aa AA seqDB search
MQYLNIKEDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVVFYLSDREPLRLGAGEYTAEEL
CIRAAQECSISPLCHNLFALYDEKTKLWYAPNHTITIDDKTSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKVPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
WFHSNDSGNILYYEVMVTGNLGIQWRQKPNVVPAEXKNKLKRKKLENKHKKDEEKIKIWE
EWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAHH
FLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVTC
SEKSEVLGSQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFVLKR
CCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDIMQGEHLGRGTRTHIYSGTL
VDYKDDEGTSEEKRIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDVE
NIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLLL
AREGIDSEFGPFIKLSDPGIPITVLTRQECIERIPWIAPECVEDSKNLSVAADKWSFGTT
LWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAIM
RDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTG
EQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSG
SLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDF
GLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSDS
SPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCTDEVYQLMRKCWEFQPSNRTSF
QSLIEGFEALLK
NT seq 3459 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatctaaatataaaagaggactgcaatgccatggctttctgtgctaaaatgagg
agctccaagaagaccgaggtgaacctggaggccccggagccaggggtggaggtggtcttc
tacctgtcggacagggagcccctccggctgggcgctggggagtacacggcggaggagctg
tgcatccgggccgcacaggaatgctctatctctcctctgtgtcataacctctttgccctg
tacgatgagaaaaccaagctctggtatgctccgaatcacaccatcaccatcgatgacaaa
acgtcgctccggctccactaccgaatgaggttctacttcaccaactggcatgggaccaat
gacaatgagcagtcagtgtggcggcattctccaaagaagcagaaaaacggctatgagaaa
aaaaaggttccagatgcaaccccacttctggatgccagctcactggagtatctgtttgct
cagggacagtatgatttggtcaaatgcctggcccccattcgagaccccaagacggagcag
gatgggcatgatatcgagaacgagtgtctgggaatggctgtcctggccatctcacactat
gctatgatgaagaagatgcagttgccagagcttcccaaggacatcagctacaagcgatat
attccagaaacgttgaataagtccatcagacagaggaaccttctcaccagaatgcgtatc
aataatgttttcaaggatttcctaaaggaatttaacaacaagaccatctgtgacagcagt
gtgtccacacatgacctgaaggtgaaatacctggctaccttggaaaccttgacaaaacat
tatggtgctgaaatatttgagacgtccatgctactgatttcatcagaaaatgagatgaat
tggtttcattcaaatgacagtggcaacatcctctactacgaagtgatggtgactggaaat
cttgggatccagtggaggcagaaacccaatgttgttcctgctgaannaaaaaataaactg
aagcggaaaaaactggaaaataaacacaaaaaggatgaggagaaaataaaaatctgggaa
gaatggaacaatttttcttacttccctgaaatcactcacattgtaataaaggagtctgtg
gttagcattaacaaacaggacaacaaaaaaatggaactgaagctctcttcccacgaggag
gccttgtcatttgtgtccctggtggacggctacttccggctcacagcagatgcccatcat
ttcctctgcaccgacgtggctcccccactgatcgttcacaacatacagaacggctgtcat
ggtccaatctgcacagaatacgccatcaataaattacggcaagaaggaagcgaggagggc
atgtacgtgctgcgatggagctgcaccgactttgacaacatcctcatgaccgtcacttgc
tcggagaagtctgaggtccttggtagccagaagcagtttaagaactttcaaatcgaggtg
cagaagggccgctacagcctgcacggctcggaccgcagcttccccagcctgggagacctc
atgagccacctcaagaagcagatcctgcgcacggacaacatcagctttgtgctgaaacgc
tgctgccagccgaagccccgagagatctccaacctgctggtggctactaagaaagcccag
gagtggcagcccgtctaccctatgagccagctgagtttcgaccggatcctcaagaaagat
atcatgcagggcgagcaccttgggagaggcacgaggacacacatctactcagggaccctg
gtggattacaaggatgacgaagggacttctgaagagaagagaataaaagtgatcctcaaa
gtcctagaccccagccacagggacatctctctggccttcttcgaggcggccagcatgatg
agacaggtgtcccacaagcacatcgtgtacctctatggcgtctgtgtccgtgacgtggag
aatatcatggttgaagagtttgtggaggggggacccctggatctcttcatgcaccggaag
agtgatgtcctcaccacgccctggaagttcaaagttgccaagcagctggccagtgccctg
agctacttggaggacaaagacctggtccatggaaacgtgtgcaccaaaaaccttctcctg
gcccgcgagggcatcgacagtgagttcggccccttcatcaagctcagcgatcccggcatc
cccatcactgtgctgaccaggcaagagtgcatcgagcggatcccatggattgcccctgag
tgtgtggaggactccaagaacctgagcgtggctgcggacaagtggagcttcgggaccaca
ctctgggaaatctgctacaacggcgagatcccgctgaaggataagacgctgattgagaaa
gagagattctatgaaagtcggtgcaggccagtgacaccatcttgcaaggagctggctgac
ctcatgacccgctgcatgaactatgaccctaaccagagacccttcttccgcgccatcatg
agagacattaacaagctggaagagcagaatccagacatagtttcggaaaaaaaaccagca
actgaggtggatcccacacattttgaaaagcgcttcctcaagaggatccgtgatttgggg
gagggccactttgggaaggtcgagctctgcaggtatgaccccgagggggacaatacaggg
gaacaggtggctgtcaagtccctgaagcccgagagtggaggtaaccacatagcagatctg
aagaaggaaatagaaatcttaaggaacctctatcacgagaacattgtgaagtacaaaggg
atctgcacagaagatggaggaaatggaattaagctcatcatggaattcttgccttcggga
agccttaaggaatatcttccaaagaataagaacaaaattaacctcaaacagcagctaaaa
tatgccgttcagatctgtaagggaatggactacttgggctctcggcagtacgttcaccgg
gacttagccgcaagaaatgttctggtggagagtgagcaccaagtcaaaattggagacttt
ggcttaaccaaagccattgaaaccgataaggagtactacaccgtcaaggatgaccgcgac
agtccagtgttttggtatgctccagaatgtttgattcagtgtaaattttatatcgcctcg
gacgtctggtctttcggagtgactctgcacgagctgcttacctactgtgattcagattct
agtcccatggccttgttcctgaaaatgataggcccaacgcacggccagatgacagtgacg
agactcgtgaacacattaaaagaaggaaagcgtttgccttgtcctcctaactgcacagat
gaggtttatcaacttatgagaaaatgctgggaattccaaccatccaatcggacatccttt
cagagccttattgaaggatttgaagcacttttaaaataa

DBGET integrated database retrieval system