KEGG   Tupaia chinensis (Chinese tree shrew): 102471872
Entry
102471872         CDS       T02978                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase 2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00220  Arginine biosynthesis
tup00330  Arginine and proline metabolism
tup01100  Metabolic pathways
tup04020  Calcium signaling pathway
tup04066  HIF-1 signaling pathway
tup04146  Peroxisome
tup04371  Apelin signaling pathway
tup04926  Relaxin signaling pathway
tup05010  Alzheimer disease
tup05014  Amyotrophic lateral sclerosis
tup05022  Pathways of neurodegeneration - multiple diseases
tup05133  Pertussis
tup05140  Leishmaniasis
tup05142  Chagas disease
tup05145  Toxoplasmosis
tup05146  Amoebiasis
tup05152  Tuberculosis
tup05200  Pathways in cancer
tup05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    102471872 (NOS2)
   00330 Arginine and proline metabolism
    102471872 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102471872 (NOS2)
   04066 HIF-1 signaling pathway
    102471872 (NOS2)
   04020 Calcium signaling pathway
    102471872 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102471872 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    102471872 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102471872 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102471872 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102471872 (NOS2)
   05014 Amyotrophic lateral sclerosis
    102471872 (NOS2)
   05022 Pathways of neurodegeneration - multiple diseases
    102471872 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    102471872 (NOS2)
   05152 Tuberculosis
    102471872 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102471872 (NOS2)
   05145 Toxoplasmosis
    102471872 (NOS2)
   05140 Leishmaniasis
    102471872 (NOS2)
   05142 Chagas disease
    102471872 (NOS2)
Enzymes [BR:tup01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     102471872 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 102471872
NCBI-ProteinID: XP_006170481
LinkDB
Position
Un
AA seq 1149 aa
MREGLGAACEATPPRLCPLLRGILRLQATCCPRQASSVTQDDPKSHSLSKLQNESSQPLA
GTGKKAPESSTRLNVRPSACPQHVRIKNWGNGMTFQDTLHHKAQRDFTCKSKSCLGAIMN
PKSLTRGCRDKPTPMEELLPQAIEFVNQYYGSFNEAKIEEHLARVEAVTKEIETTGTYQL
TGDELIFATKQAWRNAPRCIGRVQWSNLQVFDARSCSTAQEMFEHICRHLRYATNDGNIR
STITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGTILGDPASLEFTQLCIDLGWKPKYSR
FDVLPLVLQADGRDPEFFEIPPDLVLEVPMEHPKYEWFRELELRWYALPAVSNMLLEVGG
LEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDQAVIEINIA
VLHSFQKQNVTIMDHHSAAESFMKYMQNEYRTRGGCPADWVWLVPPISGSVTPVFHQEML
NYILSPFYYYQVEPWKTHVWQDEKRRPRKREIPFKVLAKAVLFASVLSRKMMASRVRVTI
LFATETGRSEALAQDLGTLFNCAFNSKVLCMDTYSLSRLEEEQLLLVVTSTFGNGDSPGN
GEKLKKSLFMLKELTNKFRYAVFGLGSSMYPQFCAFAHDIDEKLSHLGAFQLAPTGEGDE
LSGQEESFRSWAVQTFKAACECFDVRGKQHIQIPKLYTCRVTWDPHHYRLVQDPQPLELN
KALSSMHAKSVFTMRLKSQQNLHTPKSSRTTLLVELTYEGSSRLNYLPGDHLGVCPCNQL
ALVQGILERVVDGPAPQQPVRLETLDESGSYWVKDKRLPPCSLSQALTYFLDITTPPTQL
MLQKLAQLATDEAERQRLQTLAQPAEYSKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQLP
TLKPRYYSISSSQDHTPSEVHLTVAVLTYRTRDGQGPLHHGVCSTWLSSLKPQDPVPCFM
RSASGFRLPEDASHPCLLIGPGTGIAPFRSFWQQRLHDSEHKGLQGGRMTLVFGCRHPDE
DHLYRDEMLKMAWKGVLHEVHTAYSRLPGKPKVYVQDLLQQQLASEVLRVLHEEPGHLYV
CGDVRMARDVAHALKQLVAVKLSLSEEQVEDFFFQLKSQKRYHEDIFSAVFPYGLKKDGQ
QGSPEVSGI
NT seq 3450 nt   +upstreamnt  +downstreamnt
atgcgcgagggactgggcgctgcgtgtgaggccactccgccccggctctgcccgctgctc
cgcgggatcctccggctgcaggccacctgctgcccccgccaggccagctcagtgacgcag
gatgaccccaagagtcacagcctcagcaagctccagaatgaatcctcccagcccctcgca
gggacaggaaagaaggctccagaatcctccaccaggttgaacgtgcgcccgtcggcctgc
ccacagcatgtgaggatcaaaaactggggcaacgggatgactttccaggacacacttcat
cacaaggcccagagggatttcacctgcaagtccaaatcttgcctaggagccatcatgaac
cccaaaagtttgaccagaggatgcagggacaagcctacccctatggaagagctcctacct
caagctatcgaatttgtcaaccagtattatggctccttcaacgaggcaaaaatagaggaa
catctggcccgggtggaagcggtcacaaaggagatagaaacaacaggaacctaccagctg
actggcgatgagctcatctttgccaccaagcaggcctggcgcaatgccccccgctgcatc
gggagggtccagtggtccaacctgcaggtctttgatgcaaggagctgctccaccgcccaa
gagatgttcgagcacatctgcagacacctgcgctacgccaccaatgacggcaacatcagg
tcgaccatcaccgtgttcccccagcggagtgatgggaagcacgacttccgggtctggaac
gctcagctcatccgctacgctggctaccagatgcccgatggcaccatcctaggggaccct
gcctccctggagttcacccagctgtgcatcgacctgggctggaagcccaagtacagccgc
ttcgacgtgctgcctctggtcctgcaggctgacggccgtgaccccgagttcttcgaaatc
ccacctgatctcgtgcttgaggtgcccatggaacaccccaagtacgagtggttccgagag
ctggagctgaggtggtacgccctgcctgcagtgtccaacatgctgctcgaggtgggaggc
ctcgagttcccagggtgccccttcaatggctggtacatgggcacagagatcggagtccgg
gacttctgtgatgtccaacgctacaatatcctggaggaagtgggaagaaggatgggcctg
gagacacacaagctggcctcactctggaaggaccaggctgtcattgagatcaacatcgct
gtgctccatagtttccagaagcaaaatgtgaccatcatggaccaccactcggctgcggag
tccttcatgaagtacatgcagaacgaataccggacccgcgggggctgcccggccgactgg
gtttggctggtccctccgatttctgggagtgtcacgcccgtgttccaccaggagatgtta
aactacatcctgtccccgttctactactaccaggtggagccctggaaaactcacgtctgg
caggatgagaagcggagacccaggaaaagagagatcccattcaaagtcttggctaaagcc
gtgctgttcgcgtctgtgctatcgcgcaagatgatggcatcccgagtcagggtcacaatc
ctctttgcaacggagacggggaggtcggaagcgctggcacaggacctgggcaccttgttc
aactgcgccttcaactccaaggtcctctgcatggacacgtacagcctgagccgcctggag
gaggagcagctgctcctggtggtgaccagcacatttgggaatggagactcccctggcaac
ggagagaaactgaagaaatccctcttcatgctgaaggagctcaccaacaaattcaggtac
gccgtgttcggtctgggctccagcatgtacccccagttttgtgcttttgctcacgacatc
gacgagaagctgtcccacctgggggcctttcagcttgctccgacaggggaaggtgacgag
ctcagtgggcaggaggagagcttccgcagctgggctgtgcaaaccttcaaggcagcctgt
gagtgttttgatgtccggggcaaacagcacatccagatccccaagctctacacctgcagg
gtgacctgggacccacaccactaccggcttgtgcaggacccacagcctttggagctcaac
aaagccctcagcagcatgcatgctaagtccgtgttcaccatgaggctcaaatctcagcag
aacctgcataccccaaaatccagccgcaccaccctcctggtggaactcacctatgagggc
agctccagactgaactacctacccggagatcacctcggggtgtgcccatgcaaccagctg
gccctggtgcaaggcatcctggaacgagtggtggacggtcctgcaccccagcagcctgtg
cgcctggagaccctcgacgaaagcggcagctactgggtcaaggacaagaggctgcccccc
tgctcactcagccaggccctcacctacttcctggacatcaccacgcccccaacccagctg
atgctccagaagctggcccagctggccacagatgaggcggagagacagaggctgcagacc
ttggcccagcccgcagagtacagcaagtggaagttcaccaacagccccacattcctggag
gtgctggaggagttcccgtccctgcgggtgtctgctggcttcctgctctcccagctcccc
accctgaaaccccggtactactccatcagctcctcgcaggaccacaccccctcggaggtc
cacctcaccgtggccgtgctcacataccgcacccgagatggccagggccccctgcaccat
ggcgtctgcagcacatggctcagcagcctgaagccccaagacccagtgccctgcttcatg
cgaagtgccagcggcttccggctccccgaggacgcctcccatccttgcctcctcatagga
cccggcacaggcatcgcccccttccgcagtttctggcaacagcggctccatgactctgag
cacaaagggctccagggtggacgcatgaccctagtgtttgggtgccgccacccagacgag
gaccacctctatcgggatgagatgctgaagatggcctggaagggggtgctgcatgaggtg
cacacggcctactctcgcctgcccggcaagcccaaggtctatgtgcaagacctcctgcag
cagcagctggccagcgaggtgctccgtgtgctccacgaggagccgggccacctctatgtg
tgcggcgatgtgcggatggcccgggacgtggcccacgccctgaagcaactggtggcagtc
aagctgagcctcagcgaggagcaggtggaggactttttcttccagctcaagagccagaag
cgctaccatgaagatatcttcagtgctgtgtttccctacgggctgaaaaaggacgggcag
cagggaagcccagaggtctcggggatctga

DBGET integrated database retrieval system