KEGG   Tupaia chinensis (Chinese tree shrew): 102472052
Entry
102472052         CDS       T02978                                 

Gene name
RAB27B
Definition
(RefSeq) RAB27B, member RAS oncogene family
  KO
K07886  Ras-related protein Rab-27B
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:tup00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    102472052 (RAB27B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tup04131]
    102472052 (RAB27B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tup04147]
    102472052 (RAB27B)
   04031 GTP-binding proteins [BR:tup04031]
    102472052 (RAB27B)
Membrane trafficking [BR:tup04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    102472052 (RAB27B)
Exosome [BR:tup04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102472052 (RAB27B)
GTP-binding proteins [BR:tup04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab3/27 [OT]
    102472052 (RAB27B)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase MMR_HSR1 AAA_24 GTP_EFTU ATP_bind_1 AAA_22 Gtr1_RagA Septin TPP_enzyme_M
Other DBs
NCBI-GeneID: 102472052
NCBI-ProteinID: XP_006143500
LinkDB
Position
Un
AA seq 218 aa
MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNTQGPNE
SSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQAN
AYCENPDIVLIGNKADLPDQREVNERQARDLADKYGIPYFETSAATGQNVEKAVETLLDL
IMKRMEQCVEKTQVPDTVNGGNSGKLDGEKPAEKKCAC
NT seq 657 nt   +upstreamnt  +downstreamnt
atgaccgatggagactatgactatttgatcaaactcctggcccttggagattcaggggtg
gggaagacgacatttctttatagatacacggacaataaattcaaccccaaatttatcact
acagtaggaatagactttcgggaaaaacgtgtggtttataatacacaaggaccaaatgaa
tcttcagggaaagcatttaaggtgcatcttcagctttgggacactgcaggacaagagcgg
ttccgaagcctcactactgcgtttttccgagatgccatgggcttcttattaatgtttgac
ctcaccagtcaacagagcttcttaaatgtcagaaactggatgagccaactgcaagcaaat
gcttattgtgaaaatccagatatagtattaattggcaacaaggcagacctgccagaccag
agggaagtcaatgaacggcaagcccgggacctggctgacaaatacggcataccatatttt
gaaacaagtgcagcaactggacagaatgtggagaaagcagtagaaactcttctggactta
ataatgaagcgaatggaacagtgcgtggaaaagacccaagtccctgacactgtaaatggt
ggaaattctggaaaacttgatggggaaaagccagcagagaagaaatgtgcctgctag

KEGG   Tupaia chinensis (Chinese tree shrew): 102481632
Entry
102481632         CDS       T02978                                 

Gene name
RAB3D
Definition
(RefSeq) RAB3D, member RAS oncogene family
  KO
K07884  Ras-related protein Rab-3D
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:tup00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    102481632 (RAB3D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tup04131]
    102481632 (RAB3D)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tup04147]
    102481632 (RAB3D)
   04031 GTP-binding proteins [BR:tup04031]
    102481632 (RAB3D)
Membrane trafficking [BR:tup04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    102481632 (RAB3D)
Exosome [BR:tup04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102481632 (RAB3D)
GTP-binding proteins [BR:tup04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab3/27 [OT]
    102481632 (RAB3D)
SSDB
Motif
Pfam: Ras Roc Arf SRPRB Gtr1_RagA MMR_HSR1 AAA_16 DUF2757 GTP_EFTU
Other DBs
NCBI-GeneID: 102481632
NCBI-ProteinID: XP_014448375
LinkDB
Position
Un
AA seq 215 aa
MASAGDPPAGPRDAADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFK
VKTVYRHDKRIKLQIWDTAGQERYRTITTAYYRGAXMYDVANQESFAAVQDWATQIKTYS
WDNAQVILVGNKCDLEDERVVPTEDGRRLADDLGFEFFEASAKENINVKQVFERLVDVIC
EKMNESLEPASSPGSNAKGPALGDAPAPQPSTCSC
NT seq 648 nt   +upstreamnt  +downstreamnt
atggcgtcagctggagacccccctgcgggcccccgggacgcggccgaccagaacttcgac
tacatgtttaagctgctgctcatcggtaacagcagcgtgggcaagacgtccttcctgttc
cgctacgccgacgactccttcacgcccgccttcgtgagcaccgtgggcatcgacttcaag
gtcaagaccgtctaccgccatgacaagaggatcaagctgcagatctgggacacggcgggc
caggagcgctaccgcaccatcaccacagcctactaccggggcgccnagatgtacgacgtg
gccaaccaggagtccttcgccgccgtgcaggactgggccacgcagatcaagacctactcc
tgggacaacgcccaggtcatcctcgtggggaacaagtgtgacctggaggacgagcgggtt
gtgcccaccgaggacggccggaggctcgccgatgacctcggttttgagttcttcgaggcc
agcgccaaagagaacatcaacgtgaagcaggtctttgagcgcctggtggatgtcatctgc
gagaagatgaacgagtccctggaacctgcctccagcccaggcagcaacgccaaaggccca
gccctgggggacgccccggccccccagcccagcacgtgcagctgctag

KEGG   Tupaia chinensis (Chinese tree shrew): 102481788
Entry
102481788         CDS       T02978                                 

Gene name
RAB8A
Definition
(RefSeq) RAB8A, member RAS oncogene family
  KO
K07901  Ras-related protein Rab-8A
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04140  Autophagy - animal
tup04144  Endocytosis
tup04152  AMPK signaling pathway
tup04530  Tight junction
tup04972  Pancreatic secretion
tup05014  Amyotrophic lateral sclerosis
tup05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102481788 (RAB8A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102481788 (RAB8A)
   04140 Autophagy - animal
    102481788 (RAB8A)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102481788 (RAB8A)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    102481788 (RAB8A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102481788 (RAB8A)
   05022 Pathways of neurodegeneration - multiple diseases
    102481788 (RAB8A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tup04131]
    102481788 (RAB8A)
   03036 Chromosome and associated proteins [BR:tup03036]
    102481788 (RAB8A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tup04147]
    102481788 (RAB8A)
   04031 GTP-binding proteins [BR:tup04031]
    102481788 (RAB8A)
Membrane trafficking [BR:tup04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    102481788 (RAB8A)
 Autophagy
  Other autophagy associated proteins
    102481788 (RAB8A)
Chromosome and associated proteins [BR:tup03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    102481788 (RAB8A)
Exosome [BR:tup04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102481788 (RAB8A)
  Exosomal proteins of other body fluids (saliva and urine)
   102481788 (RAB8A)
  Exosomal proteins of colorectal cancer cells
   102481788 (RAB8A)
GTP-binding proteins [BR:tup04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab8/10/13 [OT]
    102481788 (RAB8A)
SSDB
Motif
Pfam: Ras Roc Arf Gtr1_RagA SRPRB MMR_HSR1 GTP_EFTU Septin DUF3963 AAA_7 Phage_holin_6_1 AAA_16
Other DBs
NCBI-GeneID: 102481788
NCBI-ProteinID: XP_006147260
LinkDB
Position
Un
AA seq 207 aa
MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ
IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG
NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN
SPQGSNQGVKITTEQQKKSSFFRCVLL
NT seq 624 nt   +upstreamnt  +downstreamnt
atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg
aagacctgtgtcctgttccgcttctccgaggacgccttcaactccactttcatctccacc
ataggaattgactttaaaattaggaccatagagcttgatggcaagaggattaagctacag
atatgggacacagccggtcaagaacggtttcggacgatcaccacggcctactacaggggc
gcgatgggcatcatgctggtctacgacatcaccaacgagaagtcctttgacaacatccgg
aactggatccggaacatcgaggagcacgcctctgcagacgtcgaaaagatgatactcggg
aacaagtgcgacgtcaacgacaagagacaggtttccaaggagcggggcgagaagctggcc
ttggactacgggatcaagttcatggagaccagtgcgaaagccaacatcaacgtggagaac
gcgtttttcaccctcgccagagacatcaaagcgaaaatggacaaaaaattggaaggcaat
agcccccaggggagcaaccagggagtcaaaatcacaacagagcagcagaagaagagcagc
tttttccgatgtgttcttctgtga

KEGG   Tupaia chinensis (Chinese tree shrew): 102489248
Entry
102489248         CDS       T02978                                 

Gene name
RAB11A
Definition
(RefSeq) RAB11A, member RAS oncogene family
  KO
K07904  Ras-related protein Rab-11A
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04144  Endocytosis
tup04961  Endocrine and other factor-regulated calcium reabsorption
tup04962  Vasopressin-regulated water reabsorption
tup04972  Pancreatic secretion
tup05164  Influenza A
Brite
KEGG Orthology (KO) [BR:tup00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102489248 (RAB11A)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    102489248 (RAB11A)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102489248 (RAB11A)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102489248 (RAB11A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    102489248 (RAB11A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tup04131]
    102489248 (RAB11A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tup04147]
    102489248 (RAB11A)
   04031 GTP-binding proteins [BR:tup04031]
    102489248 (RAB11A)
Membrane trafficking [BR:tup04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    102489248 (RAB11A)
Exosome [BR:tup04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102489248 (RAB11A)
  Exosomal proteins of colorectal cancer cells
   102489248 (RAB11A)
GTP-binding proteins [BR:tup04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab11/25 [OT]
    102489248 (RAB11A)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase AAA_22 GTP_EFTU AAA_16 PduV-EutP FeoB_N ABC_tran NTPase_1 Gtr1_RagA SRPRB TniB AAA_14 AAA_24 FAD-SLDH MCM AAA_5 AAA_21
Other DBs
NCBI-GeneID: 102489248
NCBI-ProteinID: XP_006153574
LinkDB
Position
Un
AA seq 216 aa
MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTI
KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIM
LVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQ
MSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQNI
NT seq 651 nt   +upstreamnt  +downstreamnt
atgggcacccgcgacgacgagtacgactacctcttcaaagttgtccttattggagattct
ggtgttggaaagagtaatctcctgtctcgatttactcgaaatgaatttaatctggaaagc
aagagcaccattggagtagagtttgcaacaagaagcatccaggttgacgggaaaacaatc
aaggcacagatatgggacacggcagggcaagagcgataccgagccatcacatcagcatac
tatcgtggagctgtaggtgccttattggtttatgacattgctaaacatctcacctatgaa
aatgtagagcgatggctgaaagaactgagagatcatgccgacagtaacattgttatcatg
cttgtgggcaacaagagtgatttacgtcatctcagggcagttcctacagatgaagcaaga
gcttttgcagaaaagaacggtttgtcattcattgagacatctgctctagactctacaaat
gtagaagctgcttttcagacaattctaacagagatatatcgcattgtttctcagaagcaa
atgtcagacagacgtgaaaacgacatgtctccaagcaacaatgtggttcctattcatgtc
ccaccaaccactgaaaacaagccaaaggtgcagtgctgtcagaacatctaa

DBGET integrated database retrieval system