KEGG   Tupaia chinensis (Chinese tree shrew): 102472172
Entry
102472172         CDS       T02978                                 

Gene name
AKT2
Definition
(RefSeq) AKT serine/threonine kinase 2
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01521  EGFR tyrosine kinase inhibitor resistance
tup01522  Endocrine resistance
tup01524  Platinum drug resistance
tup04010  MAPK signaling pathway
tup04012  ErbB signaling pathway
tup04014  Ras signaling pathway
tup04015  Rap1 signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04024  cAMP signaling pathway
tup04062  Chemokine signaling pathway
tup04066  HIF-1 signaling pathway
tup04068  FoxO signaling pathway
tup04071  Sphingolipid signaling pathway
tup04072  Phospholipase D signaling pathway
tup04140  Autophagy - animal
tup04150  mTOR signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04152  AMPK signaling pathway
tup04210  Apoptosis
tup04211  Longevity regulating pathway
tup04213  Longevity regulating pathway - multiple species
tup04218  Cellular senescence
tup04261  Adrenergic signaling in cardiomyocytes
tup04370  VEGF signaling pathway
tup04371  Apelin signaling pathway
tup04380  Osteoclast differentiation
tup04510  Focal adhesion
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04611  Platelet activation
tup04613  Neutrophil extracellular trap formation
tup04620  Toll-like receptor signaling pathway
tup04625  C-type lectin receptor signaling pathway
tup04630  JAK-STAT signaling pathway
tup04660  T cell receptor signaling pathway
tup04662  B cell receptor signaling pathway
tup04664  Fc epsilon RI signaling pathway
tup04666  Fc gamma R-mediated phagocytosis
tup04668  TNF signaling pathway
tup04722  Neurotrophin signaling pathway
tup04725  Cholinergic synapse
tup04728  Dopaminergic synapse
tup04910  Insulin signaling pathway
tup04914  Progesterone-mediated oocyte maturation
tup04915  Estrogen signaling pathway
tup04917  Prolactin signaling pathway
tup04919  Thyroid hormone signaling pathway
tup04920  Adipocytokine signaling pathway
tup04922  Glucagon signaling pathway
tup04923  Regulation of lipolysis in adipocytes
tup04926  Relaxin signaling pathway
tup04929  GnRH secretion
tup04931  Insulin resistance
tup04932  Non-alcoholic fatty liver disease
tup04933  AGE-RAGE signaling pathway in diabetic complications
tup04935  Growth hormone synthesis, secretion and action
tup04973  Carbohydrate digestion and absorption
tup05010  Alzheimer disease
tup05017  Spinocerebellar ataxia
tup05132  Salmonella infection
tup05135  Yersinia infection
tup05142  Chagas disease
tup05145  Toxoplasmosis
tup05152  Tuberculosis
tup05160  Hepatitis C
tup05161  Hepatitis B
tup05162  Measles
tup05163  Human cytomegalovirus infection
tup05164  Influenza A
tup05165  Human papillomavirus infection
tup05166  Human T-cell leukemia virus 1 infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05168  Herpes simplex virus 1 infection
tup05169  Epstein-Barr virus infection
tup05170  Human immunodeficiency virus 1 infection
tup05200  Pathways in cancer
tup05205  Proteoglycans in cancer
tup05210  Colorectal cancer
tup05211  Renal cell carcinoma
tup05212  Pancreatic cancer
tup05213  Endometrial cancer
tup05214  Glioma
tup05215  Prostate cancer
tup05218  Melanoma
tup05220  Chronic myeloid leukemia
tup05221  Acute myeloid leukemia
tup05222  Small cell lung cancer
tup05223  Non-small cell lung cancer
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
tup05230  Central carbon metabolism in cancer
tup05231  Choline metabolism in cancer
tup05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tup05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102472172 (AKT2)
   04012 ErbB signaling pathway
    102472172 (AKT2)
   04014 Ras signaling pathway
    102472172 (AKT2)
   04015 Rap1 signaling pathway
    102472172 (AKT2)
   04370 VEGF signaling pathway
    102472172 (AKT2)
   04371 Apelin signaling pathway
    102472172 (AKT2)
   04630 JAK-STAT signaling pathway
    102472172 (AKT2)
   04668 TNF signaling pathway
    102472172 (AKT2)
   04066 HIF-1 signaling pathway
    102472172 (AKT2)
   04068 FoxO signaling pathway
    102472172 (AKT2)
   04072 Phospholipase D signaling pathway
    102472172 (AKT2)
   04071 Sphingolipid signaling pathway
    102472172 (AKT2)
   04024 cAMP signaling pathway
    102472172 (AKT2)
   04022 cGMP-PKG signaling pathway
    102472172 (AKT2)
   04151 PI3K-Akt signaling pathway
    102472172 (AKT2)
   04152 AMPK signaling pathway
    102472172 (AKT2)
   04150 mTOR signaling pathway
    102472172 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102472172 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    102472172 (AKT2)
   04218 Cellular senescence
    102472172 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102472172 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    102472172 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102472172 (AKT2)
   04613 Neutrophil extracellular trap formation
    102472172 (AKT2)
   04620 Toll-like receptor signaling pathway
    102472172 (AKT2)
   04625 C-type lectin receptor signaling pathway
    102472172 (AKT2)
   04660 T cell receptor signaling pathway
    102472172 (AKT2)
   04662 B cell receptor signaling pathway
    102472172 (AKT2)
   04664 Fc epsilon RI signaling pathway
    102472172 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    102472172 (AKT2)
   04062 Chemokine signaling pathway
    102472172 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102472172 (AKT2)
   04922 Glucagon signaling pathway
    102472172 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    102472172 (AKT2)
   04920 Adipocytokine signaling pathway
    102472172 (AKT2)
   04929 GnRH secretion
    102472172 (AKT2)
   04915 Estrogen signaling pathway
    102472172 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    102472172 (AKT2)
   04917 Prolactin signaling pathway
    102472172 (AKT2)
   04926 Relaxin signaling pathway
    102472172 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    102472172 (AKT2)
   04919 Thyroid hormone signaling pathway
    102472172 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102472172 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102472172 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    102472172 (AKT2)
   04728 Dopaminergic synapse
    102472172 (AKT2)
   04722 Neurotrophin signaling pathway
    102472172 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102472172 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    102472172 (AKT2)
   04213 Longevity regulating pathway - multiple species
    102472172 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102472172 (AKT2)
   05205 Proteoglycans in cancer
    102472172 (AKT2)
   05230 Central carbon metabolism in cancer
    102472172 (AKT2)
   05231 Choline metabolism in cancer
    102472172 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102472172 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102472172 (AKT2)
   05212 Pancreatic cancer
    102472172 (AKT2)
   05225 Hepatocellular carcinoma
    102472172 (AKT2)
   05226 Gastric cancer
    102472172 (AKT2)
   05214 Glioma
    102472172 (AKT2)
   05221 Acute myeloid leukemia
    102472172 (AKT2)
   05220 Chronic myeloid leukemia
    102472172 (AKT2)
   05218 Melanoma
    102472172 (AKT2)
   05211 Renal cell carcinoma
    102472172 (AKT2)
   05215 Prostate cancer
    102472172 (AKT2)
   05213 Endometrial cancer
    102472172 (AKT2)
   05224 Breast cancer
    102472172 (AKT2)
   05222 Small cell lung cancer
    102472172 (AKT2)
   05223 Non-small cell lung cancer
    102472172 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102472172 (AKT2)
   05017 Spinocerebellar ataxia
    102472172 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102472172 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102472172 (AKT2)
   04931 Insulin resistance
    102472172 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102472172 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102472172 (AKT2)
   05135 Yersinia infection
    102472172 (AKT2)
   05152 Tuberculosis
    102472172 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102472172 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    102472172 (AKT2)
   05161 Hepatitis B
    102472172 (AKT2)
   05160 Hepatitis C
    102472172 (AKT2)
   05164 Influenza A
    102472172 (AKT2)
   05162 Measles
    102472172 (AKT2)
   05168 Herpes simplex virus 1 infection
    102472172 (AKT2)
   05163 Human cytomegalovirus infection
    102472172 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102472172 (AKT2)
   05169 Epstein-Barr virus infection
    102472172 (AKT2)
   05165 Human papillomavirus infection
    102472172 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102472172 (AKT2)
   05142 Chagas disease
    102472172 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102472172 (AKT2)
   01524 Platinum drug resistance
    102472172 (AKT2)
   01522 Endocrine resistance
    102472172 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tup01001]
    102472172 (AKT2)
Enzymes [BR:tup01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102472172 (AKT2)
Protein kinases [BR:tup01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   102472172 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_C PH Seadorna_VP7
Other DBs
NCBI-GeneID: 102472172
NCBI-ProteinID: XP_006140512
LinkDB
Position
Un
AA seq 419 aa
MKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRGRGEDPMDY
KCGSPSDSSAAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKI
LRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLS
RERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGIS
DGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELI
LMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKL
LPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGSLELDQRTHFPQFSYSASIRE
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgaagactgagaggccacggcccaacacctttgtcatacgctgcctgcagtggaccaca
gtcatcgagaggaccttccacgtagactctccagacgagagggaagagtggatgcgggcc
atccagatggttgccaacagcctcaagcaacggggccgaggtgaggaccccatggactac
aagtgtggctctcccagtgactcctctgcagctgaggagatggaagtggcagtcagcaag
gcacgggccaaagtgaccatgaatgacttcgactatctcaaactccttggcaagggcact
tttggcaaagtcatcctggtgcgggagaaggccactggccgctactatgctatgaagatc
ctgcggaaggaagttattattgccaaggatgaagttgctcacacggtcaccgagagccgt
gtcctccagaacaccaggcacccattcctcactgcactgaagtatgccttccagacccat
gaccgcctgtgctttgtgatggagtatgctaatggtggtgagctattcttccacttgtcc
cgggagcgcgtcttcaccgaggagcgggcacggttttatggtgcagagatcgtctcagct
ctggagtacttgcactcccgggacgtggtgtaccgtgacatcaagctggaaaacctcatg
ctggacaaagacggccacatcaagatcaccgacttcggcttgtgcaaagagggcatcagt
gatggggccaccatgaaaaccttctgtgggaccccggagtatctggcacctgaggtgctg
gaggacaacgactatggccgggctgtggactggtgggggctgggtgtggtcatgtacgag
atgatgtgcggccgtttgcccttctacaaccaggaccatgagcgcctctttgagctcatc
cttatggaggagatccgcttcccacgcacactcagccccgaggccaagtccctgcttgct
ggactgcttaagaaggaccctaagcagaggcttggtggcgggcccagtgatgccaaggaa
gtcatggagcatcggttcttcctcagtatcaactggcaggatgtggtacagaagaagctt
ctgccacccttcaaacctcaggtcacatctgaggtcgacacaaggtacttcgatgatgaa
ttcactgcccagtccatcacaatcacgccccctgaccgctatgacagcctgggctcactc
gagctggatcagcggacccacttcccccagttctcctactcggccagcatccgcgagtga

KEGG   Tupaia chinensis (Chinese tree shrew): 102474297
Entry
102474297         CDS       T02978                                 

Gene name
AKT3
Definition
(RefSeq) AKT serine/threonine kinase 3
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01521  EGFR tyrosine kinase inhibitor resistance
tup01522  Endocrine resistance
tup01524  Platinum drug resistance
tup04010  MAPK signaling pathway
tup04012  ErbB signaling pathway
tup04014  Ras signaling pathway
tup04015  Rap1 signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04024  cAMP signaling pathway
tup04062  Chemokine signaling pathway
tup04066  HIF-1 signaling pathway
tup04068  FoxO signaling pathway
tup04071  Sphingolipid signaling pathway
tup04072  Phospholipase D signaling pathway
tup04140  Autophagy - animal
tup04150  mTOR signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04152  AMPK signaling pathway
tup04210  Apoptosis
tup04211  Longevity regulating pathway
tup04213  Longevity regulating pathway - multiple species
tup04218  Cellular senescence
tup04261  Adrenergic signaling in cardiomyocytes
tup04370  VEGF signaling pathway
tup04371  Apelin signaling pathway
tup04380  Osteoclast differentiation
tup04510  Focal adhesion
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04611  Platelet activation
tup04613  Neutrophil extracellular trap formation
tup04620  Toll-like receptor signaling pathway
tup04625  C-type lectin receptor signaling pathway
tup04630  JAK-STAT signaling pathway
tup04660  T cell receptor signaling pathway
tup04662  B cell receptor signaling pathway
tup04664  Fc epsilon RI signaling pathway
tup04666  Fc gamma R-mediated phagocytosis
tup04668  TNF signaling pathway
tup04722  Neurotrophin signaling pathway
tup04725  Cholinergic synapse
tup04728  Dopaminergic synapse
tup04910  Insulin signaling pathway
tup04914  Progesterone-mediated oocyte maturation
tup04915  Estrogen signaling pathway
tup04917  Prolactin signaling pathway
tup04919  Thyroid hormone signaling pathway
tup04920  Adipocytokine signaling pathway
tup04922  Glucagon signaling pathway
tup04923  Regulation of lipolysis in adipocytes
tup04926  Relaxin signaling pathway
tup04929  GnRH secretion
tup04931  Insulin resistance
tup04932  Non-alcoholic fatty liver disease
tup04933  AGE-RAGE signaling pathway in diabetic complications
tup04935  Growth hormone synthesis, secretion and action
tup04973  Carbohydrate digestion and absorption
tup05010  Alzheimer disease
tup05017  Spinocerebellar ataxia
tup05132  Salmonella infection
tup05135  Yersinia infection
tup05142  Chagas disease
tup05145  Toxoplasmosis
tup05152  Tuberculosis
tup05160  Hepatitis C
tup05161  Hepatitis B
tup05162  Measles
tup05163  Human cytomegalovirus infection
tup05164  Influenza A
tup05165  Human papillomavirus infection
tup05166  Human T-cell leukemia virus 1 infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05168  Herpes simplex virus 1 infection
tup05169  Epstein-Barr virus infection
tup05170  Human immunodeficiency virus 1 infection
tup05200  Pathways in cancer
tup05205  Proteoglycans in cancer
tup05210  Colorectal cancer
tup05211  Renal cell carcinoma
tup05212  Pancreatic cancer
tup05213  Endometrial cancer
tup05214  Glioma
tup05215  Prostate cancer
tup05218  Melanoma
tup05220  Chronic myeloid leukemia
tup05221  Acute myeloid leukemia
tup05222  Small cell lung cancer
tup05223  Non-small cell lung cancer
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
tup05230  Central carbon metabolism in cancer
tup05231  Choline metabolism in cancer
tup05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tup05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102474297 (AKT3)
   04012 ErbB signaling pathway
    102474297 (AKT3)
   04014 Ras signaling pathway
    102474297 (AKT3)
   04015 Rap1 signaling pathway
    102474297 (AKT3)
   04370 VEGF signaling pathway
    102474297 (AKT3)
   04371 Apelin signaling pathway
    102474297 (AKT3)
   04630 JAK-STAT signaling pathway
    102474297 (AKT3)
   04668 TNF signaling pathway
    102474297 (AKT3)
   04066 HIF-1 signaling pathway
    102474297 (AKT3)
   04068 FoxO signaling pathway
    102474297 (AKT3)
   04072 Phospholipase D signaling pathway
    102474297 (AKT3)
   04071 Sphingolipid signaling pathway
    102474297 (AKT3)
   04024 cAMP signaling pathway
    102474297 (AKT3)
   04022 cGMP-PKG signaling pathway
    102474297 (AKT3)
   04151 PI3K-Akt signaling pathway
    102474297 (AKT3)
   04152 AMPK signaling pathway
    102474297 (AKT3)
   04150 mTOR signaling pathway
    102474297 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102474297 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    102474297 (AKT3)
   04218 Cellular senescence
    102474297 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102474297 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    102474297 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102474297 (AKT3)
   04613 Neutrophil extracellular trap formation
    102474297 (AKT3)
   04620 Toll-like receptor signaling pathway
    102474297 (AKT3)
   04625 C-type lectin receptor signaling pathway
    102474297 (AKT3)
   04660 T cell receptor signaling pathway
    102474297 (AKT3)
   04662 B cell receptor signaling pathway
    102474297 (AKT3)
   04664 Fc epsilon RI signaling pathway
    102474297 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    102474297 (AKT3)
   04062 Chemokine signaling pathway
    102474297 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102474297 (AKT3)
   04922 Glucagon signaling pathway
    102474297 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    102474297 (AKT3)
   04920 Adipocytokine signaling pathway
    102474297 (AKT3)
   04929 GnRH secretion
    102474297 (AKT3)
   04915 Estrogen signaling pathway
    102474297 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    102474297 (AKT3)
   04917 Prolactin signaling pathway
    102474297 (AKT3)
   04926 Relaxin signaling pathway
    102474297 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    102474297 (AKT3)
   04919 Thyroid hormone signaling pathway
    102474297 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102474297 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102474297 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    102474297 (AKT3)
   04728 Dopaminergic synapse
    102474297 (AKT3)
   04722 Neurotrophin signaling pathway
    102474297 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102474297 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    102474297 (AKT3)
   04213 Longevity regulating pathway - multiple species
    102474297 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102474297 (AKT3)
   05205 Proteoglycans in cancer
    102474297 (AKT3)
   05230 Central carbon metabolism in cancer
    102474297 (AKT3)
   05231 Choline metabolism in cancer
    102474297 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102474297 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102474297 (AKT3)
   05212 Pancreatic cancer
    102474297 (AKT3)
   05225 Hepatocellular carcinoma
    102474297 (AKT3)
   05226 Gastric cancer
    102474297 (AKT3)
   05214 Glioma
    102474297 (AKT3)
   05221 Acute myeloid leukemia
    102474297 (AKT3)
   05220 Chronic myeloid leukemia
    102474297 (AKT3)
   05218 Melanoma
    102474297 (AKT3)
   05211 Renal cell carcinoma
    102474297 (AKT3)
   05215 Prostate cancer
    102474297 (AKT3)
   05213 Endometrial cancer
    102474297 (AKT3)
   05224 Breast cancer
    102474297 (AKT3)
   05222 Small cell lung cancer
    102474297 (AKT3)
   05223 Non-small cell lung cancer
    102474297 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102474297 (AKT3)
   05017 Spinocerebellar ataxia
    102474297 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102474297 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102474297 (AKT3)
   04931 Insulin resistance
    102474297 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102474297 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102474297 (AKT3)
   05135 Yersinia infection
    102474297 (AKT3)
   05152 Tuberculosis
    102474297 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102474297 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    102474297 (AKT3)
   05161 Hepatitis B
    102474297 (AKT3)
   05160 Hepatitis C
    102474297 (AKT3)
   05164 Influenza A
    102474297 (AKT3)
   05162 Measles
    102474297 (AKT3)
   05168 Herpes simplex virus 1 infection
    102474297 (AKT3)
   05163 Human cytomegalovirus infection
    102474297 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102474297 (AKT3)
   05169 Epstein-Barr virus infection
    102474297 (AKT3)
   05165 Human papillomavirus infection
    102474297 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102474297 (AKT3)
   05142 Chagas disease
    102474297 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102474297 (AKT3)
   01524 Platinum drug resistance
    102474297 (AKT3)
   01522 Endocrine resistance
    102474297 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tup01001]
    102474297 (AKT3)
Enzymes [BR:tup01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102474297 (AKT3)
Protein kinases [BR:tup01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   102474297 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C FTA2 PH_11
Other DBs
NCBI-GeneID: 102474297
NCBI-ProteinID: XP_006157281
LinkDB
Position
Un
AA seq 465 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKCQQSDCGMLGNWKK
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaagaaggttgggttcagaagaggggagaatatataaaa
aattggagaccgagatatttccttttgaagacagatggctcattcataggatataaagaa
aaacctcaagatgtggatttaccttatcccctcaacaacttttcagtggcaaagtgccag
ttaatgaaaacagaacgaccaaagccaaacacttttattatcagatgtctccaatggacc
actgttatagagagaacatttcatgtagatactccagaggaaagagaagaatggacagaa
gctatccaggctgtagcagacagactgcagaggcaagaagaggagagaatgaattgtagt
ccaacttcacaaattgataatataggggaggaagagatggatgcttctacaacccatcat
aaaagaaagacaatgaatgattttgactatttgaaactactaggcaaaggcacttttggg
aaagttattttggttcgagagaaagcaagtgggaagtactatgctatgaagattctgaag
aaagaagtcattattgcaaaggatgaagtggcacacactctaactgaaagcagagtatta
aagaacactagacatccttttttaacatccttgaaatattccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgttaatgggggagagctgtttttccatttgtcgagagag
cgggtgttctctgaggaccgcacacgtttctatggtgcagagattgtctcagccttggac
tatctacactccggaaagattgtgtaccgtgatctcaagttggagaatttgatgctggat
aaagatggccacataaaaataacagattttggactttgcaaagaagggatcacagatgca
gccactatgaagacgttctgtggtacacctgagtacctggcaccagaggtgttagaagat
aacgactatggccgagcagtagactggtggggcctaggggttgtcatgtacgaaatgatg
tgtgggaggttacctttctacaaccaggaccatgagaaactttttgaactaatactaatg
gaggacattaaatttcctagaacactgtcttcagatgcaaaatcattgctttcagggctc
ttgataaaggatccaaataaacgacttggtggaggacctgatgatgcaaaagagattatg
agacacagtttcttttctggagtaaactggcaggatgtttatgataaaaagcttgtacct
ccttttaagcctcaagtaacatctgagacagataccagatattttgatgaagaattcaca
gctcagactattacaataacaccacctgaaaaatgtcagcaatcagattgtggcatgctg
ggtaactggaaaaaatga

KEGG   Tupaia chinensis (Chinese tree shrew): 102492771
Entry
102492771         CDS       T02978                                 

Gene name
AKT1
Definition
(RefSeq) AKT serine/threonine kinase 1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01521  EGFR tyrosine kinase inhibitor resistance
tup01522  Endocrine resistance
tup01524  Platinum drug resistance
tup04010  MAPK signaling pathway
tup04012  ErbB signaling pathway
tup04014  Ras signaling pathway
tup04015  Rap1 signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04024  cAMP signaling pathway
tup04062  Chemokine signaling pathway
tup04066  HIF-1 signaling pathway
tup04068  FoxO signaling pathway
tup04071  Sphingolipid signaling pathway
tup04072  Phospholipase D signaling pathway
tup04140  Autophagy - animal
tup04150  mTOR signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04152  AMPK signaling pathway
tup04210  Apoptosis
tup04211  Longevity regulating pathway
tup04213  Longevity regulating pathway - multiple species
tup04218  Cellular senescence
tup04261  Adrenergic signaling in cardiomyocytes
tup04370  VEGF signaling pathway
tup04371  Apelin signaling pathway
tup04380  Osteoclast differentiation
tup04510  Focal adhesion
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04611  Platelet activation
tup04613  Neutrophil extracellular trap formation
tup04620  Toll-like receptor signaling pathway
tup04625  C-type lectin receptor signaling pathway
tup04630  JAK-STAT signaling pathway
tup04660  T cell receptor signaling pathway
tup04662  B cell receptor signaling pathway
tup04664  Fc epsilon RI signaling pathway
tup04666  Fc gamma R-mediated phagocytosis
tup04668  TNF signaling pathway
tup04722  Neurotrophin signaling pathway
tup04725  Cholinergic synapse
tup04728  Dopaminergic synapse
tup04910  Insulin signaling pathway
tup04914  Progesterone-mediated oocyte maturation
tup04915  Estrogen signaling pathway
tup04917  Prolactin signaling pathway
tup04919  Thyroid hormone signaling pathway
tup04920  Adipocytokine signaling pathway
tup04922  Glucagon signaling pathway
tup04923  Regulation of lipolysis in adipocytes
tup04926  Relaxin signaling pathway
tup04929  GnRH secretion
tup04931  Insulin resistance
tup04932  Non-alcoholic fatty liver disease
tup04933  AGE-RAGE signaling pathway in diabetic complications
tup04935  Growth hormone synthesis, secretion and action
tup04973  Carbohydrate digestion and absorption
tup05010  Alzheimer disease
tup05017  Spinocerebellar ataxia
tup05132  Salmonella infection
tup05135  Yersinia infection
tup05142  Chagas disease
tup05145  Toxoplasmosis
tup05152  Tuberculosis
tup05160  Hepatitis C
tup05161  Hepatitis B
tup05162  Measles
tup05163  Human cytomegalovirus infection
tup05164  Influenza A
tup05165  Human papillomavirus infection
tup05166  Human T-cell leukemia virus 1 infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05168  Herpes simplex virus 1 infection
tup05169  Epstein-Barr virus infection
tup05170  Human immunodeficiency virus 1 infection
tup05200  Pathways in cancer
tup05205  Proteoglycans in cancer
tup05210  Colorectal cancer
tup05211  Renal cell carcinoma
tup05212  Pancreatic cancer
tup05213  Endometrial cancer
tup05214  Glioma
tup05215  Prostate cancer
tup05218  Melanoma
tup05220  Chronic myeloid leukemia
tup05221  Acute myeloid leukemia
tup05222  Small cell lung cancer
tup05223  Non-small cell lung cancer
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
tup05230  Central carbon metabolism in cancer
tup05231  Choline metabolism in cancer
tup05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tup05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102492771 (AKT1)
   04012 ErbB signaling pathway
    102492771 (AKT1)
   04014 Ras signaling pathway
    102492771 (AKT1)
   04015 Rap1 signaling pathway
    102492771 (AKT1)
   04370 VEGF signaling pathway
    102492771 (AKT1)
   04371 Apelin signaling pathway
    102492771 (AKT1)
   04630 JAK-STAT signaling pathway
    102492771 (AKT1)
   04668 TNF signaling pathway
    102492771 (AKT1)
   04066 HIF-1 signaling pathway
    102492771 (AKT1)
   04068 FoxO signaling pathway
    102492771 (AKT1)
   04072 Phospholipase D signaling pathway
    102492771 (AKT1)
   04071 Sphingolipid signaling pathway
    102492771 (AKT1)
   04024 cAMP signaling pathway
    102492771 (AKT1)
   04022 cGMP-PKG signaling pathway
    102492771 (AKT1)
   04151 PI3K-Akt signaling pathway
    102492771 (AKT1)
   04152 AMPK signaling pathway
    102492771 (AKT1)
   04150 mTOR signaling pathway
    102492771 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102492771 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    102492771 (AKT1)
   04218 Cellular senescence
    102492771 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102492771 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102492771 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102492771 (AKT1)
   04613 Neutrophil extracellular trap formation
    102492771 (AKT1)
   04620 Toll-like receptor signaling pathway
    102492771 (AKT1)
   04625 C-type lectin receptor signaling pathway
    102492771 (AKT1)
   04660 T cell receptor signaling pathway
    102492771 (AKT1)
   04662 B cell receptor signaling pathway
    102492771 (AKT1)
   04664 Fc epsilon RI signaling pathway
    102492771 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    102492771 (AKT1)
   04062 Chemokine signaling pathway
    102492771 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102492771 (AKT1)
   04922 Glucagon signaling pathway
    102492771 (AKT1)
   04923 Regulation of lipolysis in adipocytes
    102492771 (AKT1)
   04920 Adipocytokine signaling pathway
    102492771 (AKT1)
   04929 GnRH secretion
    102492771 (AKT1)
   04915 Estrogen signaling pathway
    102492771 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    102492771 (AKT1)
   04917 Prolactin signaling pathway
    102492771 (AKT1)
   04926 Relaxin signaling pathway
    102492771 (AKT1)
   04935 Growth hormone synthesis, secretion and action
    102492771 (AKT1)
   04919 Thyroid hormone signaling pathway
    102492771 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102492771 (AKT1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102492771 (AKT1)
  09156 Nervous system
   04725 Cholinergic synapse
    102492771 (AKT1)
   04728 Dopaminergic synapse
    102492771 (AKT1)
   04722 Neurotrophin signaling pathway
    102492771 (AKT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102492771 (AKT1)
  09149 Aging
   04211 Longevity regulating pathway
    102492771 (AKT1)
   04213 Longevity regulating pathway - multiple species
    102492771 (AKT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102492771 (AKT1)
   05205 Proteoglycans in cancer
    102492771 (AKT1)
   05230 Central carbon metabolism in cancer
    102492771 (AKT1)
   05231 Choline metabolism in cancer
    102492771 (AKT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102492771 (AKT1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102492771 (AKT1)
   05212 Pancreatic cancer
    102492771 (AKT1)
   05225 Hepatocellular carcinoma
    102492771 (AKT1)
   05226 Gastric cancer
    102492771 (AKT1)
   05214 Glioma
    102492771 (AKT1)
   05221 Acute myeloid leukemia
    102492771 (AKT1)
   05220 Chronic myeloid leukemia
    102492771 (AKT1)
   05218 Melanoma
    102492771 (AKT1)
   05211 Renal cell carcinoma
    102492771 (AKT1)
   05215 Prostate cancer
    102492771 (AKT1)
   05213 Endometrial cancer
    102492771 (AKT1)
   05224 Breast cancer
    102492771 (AKT1)
   05222 Small cell lung cancer
    102492771 (AKT1)
   05223 Non-small cell lung cancer
    102492771 (AKT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102492771 (AKT1)
   05017 Spinocerebellar ataxia
    102492771 (AKT1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102492771 (AKT1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102492771 (AKT1)
   04931 Insulin resistance
    102492771 (AKT1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102492771 (AKT1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102492771 (AKT1)
   05135 Yersinia infection
    102492771 (AKT1)
   05152 Tuberculosis
    102492771 (AKT1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102492771 (AKT1)
   05170 Human immunodeficiency virus 1 infection
    102492771 (AKT1)
   05161 Hepatitis B
    102492771 (AKT1)
   05160 Hepatitis C
    102492771 (AKT1)
   05164 Influenza A
    102492771 (AKT1)
   05162 Measles
    102492771 (AKT1)
   05168 Herpes simplex virus 1 infection
    102492771 (AKT1)
   05163 Human cytomegalovirus infection
    102492771 (AKT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102492771 (AKT1)
   05169 Epstein-Barr virus infection
    102492771 (AKT1)
   05165 Human papillomavirus infection
    102492771 (AKT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102492771 (AKT1)
   05142 Chagas disease
    102492771 (AKT1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102492771 (AKT1)
   01524 Platinum drug resistance
    102492771 (AKT1)
   01522 Endocrine resistance
    102492771 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tup01001]
    102492771 (AKT1)
Enzymes [BR:tup01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102492771 (AKT1)
Protein kinases [BR:tup01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   102492771 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 102492771
NCBI-ProteinID: XP_014447718
LinkDB
Position
Un
AA seq 480 aa
MDDVAVVKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEGMDF
RPGSPSDSSGAEDMEVSLARPKHRVTMSEFEYLKLLGKGTFGKVILVKERATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSKHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHVKITDFGLCKEGI
KDGATMRTFCGTPEYLAPEVLEDNDYGRAVGWWGLGVVMYEMLCGRLPFYNQDHEKLFEL
ILMEDIRFPRTLGPEARALLAGLLKKDPRQRLGGGPEDAKEIMRHRFFANIVWQDVYEKK
LSPPFRPQVTSETDTRYFDEEFTAQIITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggacgacgtggctgtcgtgaaggagggctggctacacaaacgaggggagtacatcaag
acctggcggccgcgctacttccttctcaagagcgacggcagcttcattggctacaaggag
cggccgcaggacgtggaccagcgcgaggcccccctcaacaacttctccgtggcgcagtgc
cagctgatgaagacggagcggccgcggcccaacaccttcatcatccgctgcctgcagtgg
accacagtcatcgagcgcaccttccacgtggagacgcccgaggaacgggaggagtggacc
actgccattcagacggtggcagacgggctcaagaagcaagaggaggaggggatggacttc
cggccaggctcgcccagtgacagctcgggggccgaggacatggaggtgtcactggccagg
cccaagcaccgtgtgaccatgagcgagttcgagtacctgaagctgctgggcaagggcacc
tttgggaaggtgatcctggtgaaggagagggccaccgggcgctactacgccatgaagatc
ctcaagaaggaggtcatcgtggccaaggacgaggtggcccacacgctcacagagaaccga
gtcctgcagaactccaagcaccccttcctcacggccctgaaatactccttccagacccac
gaccgcctctgcttcgtcatggagtacgccaacgggggcgagctcttcttccatctgtcg
cgggagcgtgtgttctccgaggaccgggcccgcttctacggcgcagagatcgtgtcggcc
ctggactacctgcactcggagaagaacgtggtgtaccgcgacctcaagctggagaacctc
atgctggacaaggacggccacgtgaagatcacggacttcgggctgtgcaaggagggcata
aaggacggcgccaccatgcggaccttctgcgggacgcccgagtacctggcgcccgaggtg
ctggaggacaacgactacggcagggccgtgggctggtgggggctgggcgtggtcatgtac
gagatgctctgcggccgcctgcccttctacaaccaggaccacgagaagctcttcgagctc
atcctcatggaggacatccgcttcccgcgcaccctcggccccgaagccagggcgctgctc
gctgggctgctcaagaaggacccccggcagaggctcggcgggggccccgaggacgccaag
gagatcatgcggcaccgcttcttcgccaacatcgtgtggcaggacgtgtacgagaagaag
ctcagcccgcccttcaggcctcaggtcacgtctgagacggacaccaggtacttcgatgag
gagttcaccgcccagataatcaccatcacgccacctgaccaagatgacagcatggagtgt
gtggacagcgagcggaggccccacttcccgcagttctcctactccgccagcggcacggcc
tga

DBGET integrated database retrieval system