KEGG   Tupaia chinensis (Chinese tree shrew): 102472532
Entry
102472532         CDS       T02978                                 

Gene name
PLCB3
Definition
(RefSeq) phospholipase C beta 3
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00562  Inositol phosphate metabolism
tup01100  Metabolic pathways
tup04015  Rap1 signaling pathway
tup04020  Calcium signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04062  Chemokine signaling pathway
tup04070  Phosphatidylinositol signaling system
tup04071  Sphingolipid signaling pathway
tup04072  Phospholipase D signaling pathway
tup04261  Adrenergic signaling in cardiomyocytes
tup04270  Vascular smooth muscle contraction
tup04310  Wnt signaling pathway
tup04371  Apelin signaling pathway
tup04540  Gap junction
tup04611  Platelet activation
tup04621  NOD-like receptor signaling pathway
tup04713  Circadian entrainment
tup04720  Long-term potentiation
tup04723  Retrograde endocannabinoid signaling
tup04724  Glutamatergic synapse
tup04725  Cholinergic synapse
tup04726  Serotonergic synapse
tup04728  Dopaminergic synapse
tup04730  Long-term depression
tup04742  Taste transduction
tup04750  Inflammatory mediator regulation of TRP channels
tup04911  Insulin secretion
tup04912  GnRH signaling pathway
tup04915  Estrogen signaling pathway
tup04916  Melanogenesis
tup04918  Thyroid hormone synthesis
tup04919  Thyroid hormone signaling pathway
tup04921  Oxytocin signaling pathway
tup04922  Glucagon signaling pathway
tup04924  Renin secretion
tup04925  Aldosterone synthesis and secretion
tup04926  Relaxin signaling pathway
tup04927  Cortisol synthesis and secretion
tup04928  Parathyroid hormone synthesis, secretion and action
tup04929  GnRH secretion
tup04933  AGE-RAGE signaling pathway in diabetic complications
tup04934  Cushing syndrome
tup04935  Growth hormone synthesis, secretion and action
tup04961  Endocrine and other factor-regulated calcium reabsorption
tup04970  Salivary secretion
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup04973  Carbohydrate digestion and absorption
tup05010  Alzheimer disease
tup05016  Huntington disease
tup05017  Spinocerebellar ataxia
tup05022  Pathways of neurodegeneration - multiple diseases
tup05142  Chagas disease
tup05143  African trypanosomiasis
tup05146  Amoebiasis
tup05163  Human cytomegalovirus infection
tup05200  Pathways in cancer
Module
tup_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102472532 (PLCB3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102472532 (PLCB3)
   04310 Wnt signaling pathway
    102472532 (PLCB3)
   04371 Apelin signaling pathway
    102472532 (PLCB3)
   04020 Calcium signaling pathway
    102472532 (PLCB3)
   04070 Phosphatidylinositol signaling system
    102472532 (PLCB3)
   04072 Phospholipase D signaling pathway
    102472532 (PLCB3)
   04071 Sphingolipid signaling pathway
    102472532 (PLCB3)
   04022 cGMP-PKG signaling pathway
    102472532 (PLCB3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102472532 (PLCB3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102472532 (PLCB3)
   04621 NOD-like receptor signaling pathway
    102472532 (PLCB3)
   04062 Chemokine signaling pathway
    102472532 (PLCB3)
  09152 Endocrine system
   04911 Insulin secretion
    102472532 (PLCB3)
   04922 Glucagon signaling pathway
    102472532 (PLCB3)
   04929 GnRH secretion
    102472532 (PLCB3)
   04912 GnRH signaling pathway
    102472532 (PLCB3)
   04915 Estrogen signaling pathway
    102472532 (PLCB3)
   04921 Oxytocin signaling pathway
    102472532 (PLCB3)
   04926 Relaxin signaling pathway
    102472532 (PLCB3)
   04935 Growth hormone synthesis, secretion and action
    102472532 (PLCB3)
   04918 Thyroid hormone synthesis
    102472532 (PLCB3)
   04919 Thyroid hormone signaling pathway
    102472532 (PLCB3)
   04928 Parathyroid hormone synthesis, secretion and action
    102472532 (PLCB3)
   04916 Melanogenesis
    102472532 (PLCB3)
   04924 Renin secretion
    102472532 (PLCB3)
   04925 Aldosterone synthesis and secretion
    102472532 (PLCB3)
   04927 Cortisol synthesis and secretion
    102472532 (PLCB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102472532 (PLCB3)
   04270 Vascular smooth muscle contraction
    102472532 (PLCB3)
  09154 Digestive system
   04970 Salivary secretion
    102472532 (PLCB3)
   04971 Gastric acid secretion
    102472532 (PLCB3)
   04972 Pancreatic secretion
    102472532 (PLCB3)
   04973 Carbohydrate digestion and absorption
    102472532 (PLCB3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    102472532 (PLCB3)
  09156 Nervous system
   04724 Glutamatergic synapse
    102472532 (PLCB3)
   04725 Cholinergic synapse
    102472532 (PLCB3)
   04728 Dopaminergic synapse
    102472532 (PLCB3)
   04726 Serotonergic synapse
    102472532 (PLCB3)
   04720 Long-term potentiation
    102472532 (PLCB3)
   04730 Long-term depression
    102472532 (PLCB3)
   04723 Retrograde endocannabinoid signaling
    102472532 (PLCB3)
  09157 Sensory system
   04742 Taste transduction
    102472532 (PLCB3)
   04750 Inflammatory mediator regulation of TRP channels
    102472532 (PLCB3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102472532 (PLCB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102472532 (PLCB3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102472532 (PLCB3)
   05016 Huntington disease
    102472532 (PLCB3)
   05017 Spinocerebellar ataxia
    102472532 (PLCB3)
   05022 Pathways of neurodegeneration - multiple diseases
    102472532 (PLCB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102472532 (PLCB3)
   04934 Cushing syndrome
    102472532 (PLCB3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102472532 (PLCB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102472532 (PLCB3)
   05142 Chagas disease
    102472532 (PLCB3)
   05143 African trypanosomiasis
    102472532 (PLCB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tup04131]
    102472532 (PLCB3)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     102472532 (PLCB3)
Membrane trafficking [BR:tup04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    102472532 (PLCB3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    102472532 (PLCB3)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like C2 DUF1154
Other DBs
NCBI-GeneID: 102472532
NCBI-ProteinID: XP_006149998
LinkDB
Position
Un
AA seq 1232 aa
MAGARPGVHALQLEPPTVVETLRRGSKFIKWDEEASSRNLVTLRVDPNGFFLYWTGPNME
VDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPNARLEEKLMTVVAGPDPVNTTFLNF
MAVQDDTAKVWSEELFKLAMNILAQNASRNTFLHKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLNFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRPSQARLLIEKYEPNQQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSADMSQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIDPLDKYPLAPGVALPSPQDLMGRILVKNKKRHRPSTGIPDS
SGRKRPLEQSNSALSESSAPTQPSSPQLGSPSSDSCPGLSNGEEVGLEKPSLEPRKSLGE
ENLNRGPDTLGPADREEEEEDEEEEEQTDPKKPTTDEGTASSEVNATEEMSTLVNYIEPV
KFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNYM
PQLFWNVGCQLVALNFQTLDLPMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVIV
DGIVANALRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEEP
FDFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYVCLRNEANQPLCLPALLI
YTEASDYIPDDHQDYAEALINPIKHVSLMDQRAKQLAALIGESEAQAGPETCQETQSQQL
GSQLSPNPTPSPLDTSSRRPPGPAASPTNTSVSSPGQREDLIASLLSEVAPAPLDELRGH
KALVKLRSRQERELRELHKKHQRKAVALTRRLLDNLAQARAESRGRPRPGVQGGAADMED
TKEEEEEVKRYQEFQNRQVQSLLELREAQADAEAERRREHLRQAQQRLREVVLDAHVAQF
KRLKEMNEREKKELQKILDRKRHNSISEAKTREKHKKEAELTEINRRHITESVNSIRRLE
EAQRQRHDRLASGQQQVLQQLAEEEPKLLAQLAQECQEWPGGQEIRRSLLGETPEGLGDR
ALVVCASNGHAPGSGGHLSSADSESQEENTQL
NT seq 3699 nt   +upstreamnt  +downstreamnt
atggcgggcgccaggcccggcgtccacgcgctgcagctggagccgcccactgtagtggag
accctgcggcgcgggagtaagttcatcaaatgggacgaggaggcctccagtcggaacctg
gtgactctgcgcgtggacccaaatggcttcttcttgtactggacgggacccaacatggag
gtggacacactggacatcagttccatcagggacacgaggacgggccgttatgcccgcctg
cccaaggaccccaagatccgagaagttctgggctttgggggccccaatgcccgactggaa
gagaagctgatgacggtagtagctgggccagacccggtgaacacaacgttcttgaacttc
atggccgtgcaggatgacacagccaaggtctggtccgaggagctattcaagctggctatg
aacatcctggcccagaatgcttcccggaacaccttcctgcacaaagcatacacgaagctg
aagctgcaggtgaaccaggatggacggattccagtcaagaacatccttaagatgttctct
gcggacaagaagcgcgtggagactgcactggagtcctgtggcctcaacttcaaccggagt
gagtccatccggccagatgagttttccttggaaatctttgagcggttcctcaacaagcta
tgtctgcggccagacattgacaagatcctgctggagataggcgccaagggcaagccgtac
ctgacgctggaacagctcatggacttcatcaaccagaagcaacgggacccaagactcaat
gaagtgctgtacccgccgctgcggccctcccaggcccggctgctcatcgagaagtatgag
cccaaccagcagttcctggagcgagaccagatgtccatggagggcttcagccgctacctg
ggaggtgaggagaacggcatcctgcccctggaagccctggacctgagtgcagacatgagc
cagccgctgagtgcctacttcatcaactcctcacacaacacctatctcacggcggggcag
ttggctgggacctcgtcggtggagatgtaccgccaagcactgctgtgggggtgccgctgt
gtggagctggatgtatggaaggggcggccacccgaggaggagcctttcatcacccatggc
ttcactatgaccacggaggtgccactgcgtgatgtgctagaggccatcgctgagaccgcc
ttcaagacctccccctatcccgtcatcctctcctttgagaaccatgtggactcggcgaag
cagcaggccaagatggctgagtactgccgctccatctttggggatgcgctgctcatcgac
ccactggacaagtacccgctggctccgggcgtcgccctgcccagcccccaggacctgatg
ggacgcatcctggtgaagaacaagaagcggcaccggcctagcacgggcatccccgacagc
tcggggcgcaagcggccgttggagcagagcaactcggccctgagtgagagctcagccccc
acccagccctcctctccccagctcgggtcccccagctccgacagctgcccaggcctgagc
aatggggaggaggtggggctcgagaagcccagcctagagcctcggaagtctctaggtgag
gagaacctgaaccggggccctgacacccttggacctgcagaccgtgaggaagaagaggaa
gacgaggaagaggaggaacagactgaccccaaaaagcccaccacagatgagggcacggcg
agcagtgaggtcaacgccactgaggagatgtcaacgcttgtcaactatattgagcccgtc
aagttcaagtcctttgaggcagctcgaaagaggaacaagtgctttgagatgtcgtccttc
gtggagaccaaggccatggagcagctgacgaagagccccatggagtttgtggaatacaac
aagcagcagcttagccgcatctaccccaagggcacccgtgtggactcttccaactacatg
ccccagctcttctggaacgtaggctgccagcttgtggcgctcaacttccagaccctggac
ttgccaatgcagctgaacgcgggcgtatttgagtacaatgggcgcagcgggtacctgctc
aagcctgagttcatgcggcgtccagacaagtcctttgaccccttcactgaggtcatcgtg
gacggcattgtagccaatgccttgcgagtcaaggtgatctcggggcagttcctgtctgac
aggaaggtgggcatctacgtggaggtggacatgtttggcctccccgttgatacacggcgc
aagtaccgcacacggacctcacaggggaactcgttcaaccctgtgtgggacgaggagccc
ttcgacttccccaaggtggtgctgcccacgctggcttcccttcgcattgcggcctttgag
gagggcggcaaattcgtagggcaccggatcctgcccgtgtcagccatccgctcagggtac
cactacgtctgcctgcggaacgaggccaaccagccgctgtgcctgccagccctgctcatc
tacactgaggcctccgactatatccctgacgaccaccaggactatgcggaggctctaatc
aaccctattaaacatgtcagcctgatggaccagagggccaagcagctggctgccctcatt
ggggagagtgaggcccaggctggcccagagacatgccaggagacccagtctcagcagctg
gggtcccagttatccccaaaccccacccctagcccactggacacctcctcccgccggccc
ccaggccctgctgcctctcccaccaacacctctgtcagcagcccagggcagcgggaggat
ctcattgctagcctcctctcagaggtggccccagctccattggacgagctgcgagggcac
aaggcgctagtgaagctccgcagccggcaggagcgggagctacgggagctgcacaagaag
caccagcggaaggcggtggccctcactcgccgtctgcttgacaacctggcccaggcccgg
gccgagagcaggggccggccccggccaggagtccaaggcggggctgctgatatggaggac
acaaaggaggaggaggaagaagtgaagcggtatcaggagttccagaacagacaggtgcag
agtctgctggagttgagggaggcccaggcagatgcagaggccgagcggaggcgggagcac
ctgagacaggcccagcagcggctcagggaggtcgtcctggatgctcatgtggctcagttc
aagaggctgaaggagatgaacgagagggaaaagaaagagctgcagaagatcctggacagg
aaacgccacaacagtatctcagaggccaagacgagggagaaacacaagaaggaggcggaa
ctgacagagattaaccgtcggcacatcaccgagtcggtcaactccatccgtcggctggag
gaggcccagaggcagcggcatgatcgcctcgcgtctgggcagcagcaggtcctccagcag
ctggcggaagaagagcccaagctgctggcccagctggcccaggagtgtcaggagtggccg
ggggggcaggagatccgccggagcctgctgggcgagacgccagaggggcttggggacagg
gccctcgtggtctgtgccagcaacggtcacgcgcctgggagcggtgggcacctgtccagt
gcagactccgagagccaggaggagaacacgcagctctga

KEGG   Tupaia chinensis (Chinese tree shrew): 102476196
Entry
102476196         CDS       T02978                                 

Gene name
PLCB4
Definition
(RefSeq) phospholipase C beta 4
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00562  Inositol phosphate metabolism
tup01100  Metabolic pathways
tup04015  Rap1 signaling pathway
tup04020  Calcium signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04062  Chemokine signaling pathway
tup04070  Phosphatidylinositol signaling system
tup04071  Sphingolipid signaling pathway
tup04072  Phospholipase D signaling pathway
tup04261  Adrenergic signaling in cardiomyocytes
tup04270  Vascular smooth muscle contraction
tup04310  Wnt signaling pathway
tup04371  Apelin signaling pathway
tup04540  Gap junction
tup04611  Platelet activation
tup04621  NOD-like receptor signaling pathway
tup04713  Circadian entrainment
tup04720  Long-term potentiation
tup04723  Retrograde endocannabinoid signaling
tup04724  Glutamatergic synapse
tup04725  Cholinergic synapse
tup04726  Serotonergic synapse
tup04728  Dopaminergic synapse
tup04730  Long-term depression
tup04742  Taste transduction
tup04750  Inflammatory mediator regulation of TRP channels
tup04911  Insulin secretion
tup04912  GnRH signaling pathway
tup04915  Estrogen signaling pathway
tup04916  Melanogenesis
tup04918  Thyroid hormone synthesis
tup04919  Thyroid hormone signaling pathway
tup04921  Oxytocin signaling pathway
tup04922  Glucagon signaling pathway
tup04924  Renin secretion
tup04925  Aldosterone synthesis and secretion
tup04926  Relaxin signaling pathway
tup04927  Cortisol synthesis and secretion
tup04928  Parathyroid hormone synthesis, secretion and action
tup04929  GnRH secretion
tup04933  AGE-RAGE signaling pathway in diabetic complications
tup04934  Cushing syndrome
tup04935  Growth hormone synthesis, secretion and action
tup04961  Endocrine and other factor-regulated calcium reabsorption
tup04970  Salivary secretion
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup04973  Carbohydrate digestion and absorption
tup05010  Alzheimer disease
tup05016  Huntington disease
tup05017  Spinocerebellar ataxia
tup05022  Pathways of neurodegeneration - multiple diseases
tup05142  Chagas disease
tup05143  African trypanosomiasis
tup05146  Amoebiasis
tup05163  Human cytomegalovirus infection
tup05200  Pathways in cancer
Module
tup_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102476196 (PLCB4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102476196 (PLCB4)
   04310 Wnt signaling pathway
    102476196 (PLCB4)
   04371 Apelin signaling pathway
    102476196 (PLCB4)
   04020 Calcium signaling pathway
    102476196 (PLCB4)
   04070 Phosphatidylinositol signaling system
    102476196 (PLCB4)
   04072 Phospholipase D signaling pathway
    102476196 (PLCB4)
   04071 Sphingolipid signaling pathway
    102476196 (PLCB4)
   04022 cGMP-PKG signaling pathway
    102476196 (PLCB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102476196 (PLCB4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102476196 (PLCB4)
   04621 NOD-like receptor signaling pathway
    102476196 (PLCB4)
   04062 Chemokine signaling pathway
    102476196 (PLCB4)
  09152 Endocrine system
   04911 Insulin secretion
    102476196 (PLCB4)
   04922 Glucagon signaling pathway
    102476196 (PLCB4)
   04929 GnRH secretion
    102476196 (PLCB4)
   04912 GnRH signaling pathway
    102476196 (PLCB4)
   04915 Estrogen signaling pathway
    102476196 (PLCB4)
   04921 Oxytocin signaling pathway
    102476196 (PLCB4)
   04926 Relaxin signaling pathway
    102476196 (PLCB4)
   04935 Growth hormone synthesis, secretion and action
    102476196 (PLCB4)
   04918 Thyroid hormone synthesis
    102476196 (PLCB4)
   04919 Thyroid hormone signaling pathway
    102476196 (PLCB4)
   04928 Parathyroid hormone synthesis, secretion and action
    102476196 (PLCB4)
   04916 Melanogenesis
    102476196 (PLCB4)
   04924 Renin secretion
    102476196 (PLCB4)
   04925 Aldosterone synthesis and secretion
    102476196 (PLCB4)
   04927 Cortisol synthesis and secretion
    102476196 (PLCB4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102476196 (PLCB4)
   04270 Vascular smooth muscle contraction
    102476196 (PLCB4)
  09154 Digestive system
   04970 Salivary secretion
    102476196 (PLCB4)
   04971 Gastric acid secretion
    102476196 (PLCB4)
   04972 Pancreatic secretion
    102476196 (PLCB4)
   04973 Carbohydrate digestion and absorption
    102476196 (PLCB4)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    102476196 (PLCB4)
  09156 Nervous system
   04724 Glutamatergic synapse
    102476196 (PLCB4)
   04725 Cholinergic synapse
    102476196 (PLCB4)
   04728 Dopaminergic synapse
    102476196 (PLCB4)
   04726 Serotonergic synapse
    102476196 (PLCB4)
   04720 Long-term potentiation
    102476196 (PLCB4)
   04730 Long-term depression
    102476196 (PLCB4)
   04723 Retrograde endocannabinoid signaling
    102476196 (PLCB4)
  09157 Sensory system
   04742 Taste transduction
    102476196 (PLCB4)
   04750 Inflammatory mediator regulation of TRP channels
    102476196 (PLCB4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102476196 (PLCB4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102476196 (PLCB4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102476196 (PLCB4)
   05016 Huntington disease
    102476196 (PLCB4)
   05017 Spinocerebellar ataxia
    102476196 (PLCB4)
   05022 Pathways of neurodegeneration - multiple diseases
    102476196 (PLCB4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102476196 (PLCB4)
   04934 Cushing syndrome
    102476196 (PLCB4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102476196 (PLCB4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102476196 (PLCB4)
   05142 Chagas disease
    102476196 (PLCB4)
   05143 African trypanosomiasis
    102476196 (PLCB4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tup04131]
    102476196 (PLCB4)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     102476196 (PLCB4)
Membrane trafficking [BR:tup04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    102476196 (PLCB4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    102476196 (PLCB4)
SSDB
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y DUF1154 EF-hand_like C2 EF-hand_7 EF-hand_6
Other DBs
NCBI-GeneID: 102476196
NCBI-ProteinID: XP_006150982
LinkDB
Position
Un
AA seq 1194 aa
MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVL
ECSLINSIRLGAIPKDPKILAALEAVGKSENDLEGRIVCVCSGIDLVNINFTYMVAENPE
VTKQWVEGLRAIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKKGLISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKRLKPEVEKKQLEALKSM
MEAGESAAPANILEDDNEEEIENADQEEEAHPEYKFGNELSADDLGHKEAVANSVKKGLV
TVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVG
LGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQL
NQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGT
YVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLAVLRIAVYDDNNK
LIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKK
FLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANTAKANVTPQSSSELRPTTTAA
MGSGVEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQ
VDKIVAQYDKEKSTHEKTLEKAMKKKGGSNCLEMKKETEIKIQTLTSDHKSKVKEIVAQH
TKEWSEMINTHSAEEQEIRDLHLSQQCDLLKKLLINAHEQQTQQLKLSHDREKKEMRAHQ
AKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSKEMDQLKKVQ
LEHLEFLEKQNEQLLKTCHAVSQTQGEGDAADGEIGSRDGPQTSNSSMKLQNAN
NT seq 3585 nt   +upstreamnt  +downstreamnt
atggccaaaccttatgaatttaactggcagaaagaagttccttcctttttgcaagaagga
gcagtttttgacagatacgaggaggaatccttcgtatttgaacccaactgcctcttcaaa
gtggatgaatttggcttctttctgacctggaaaagtgaaggcaaggaagggcaagtgcta
gaatgttccctcatcaacagtatccggttgggagccataccaaaggatcccaaaattctg
gctgctcttgaagctgttggaaaatcagaaaatgatctggaagggcggatagtttgtgtc
tgcagtggtatagatttggtgaacataaacttcacttacatggtggccgaaaatccagaa
gtaactaagcaatgggtagaaggcctgagagcaatcatacacaacttcagggccaacaac
gtcagtccaatgacatgcctcaagaaacactggatgaaattggcatttatgaccaacaca
aatggtaaaattccagttagaagtattactagaacttttgcatcgggaaaaacagaaaag
gtgatctttcaagcactcaaggaattaggtcttcccagtggaaagaatgatgaaattgag
cctgcagcatttacttatgaaaagttctatgaactgacacaaaagatttgtcctcggaca
gacatagaagatctttttaaaaaaatcaatggagacaaaactgattatttaacggtagac
caattagtgagctttctaaatgaacatcaacgagatcctcgactgaatgaaattttattt
ccattttatgatgctaaaagggcaatgcagatcattgagatgtatgagcctgatgaagat
ttaaagaaaaaaggcctcatatccagtgacgggttttgcagatatctgatgtccgatgaa
aatgccccggtcttcctagatcgcttagaactttaccaagaaatggaccatcctctggct
cactacttcatcagttcttcccataacacctacctcacgggccggcagtttggtggcaag
tcttcggtagaaatgtacagacaggttctcctggctggttgcagatgtgttgagcttgat
tgttgggatggaaaaggtgaagatcaggaaccgataataactcatggaaaagcaatgtgt
acagatatccttttcaaggatgtgattcaagccatcaaggaaactgcatttgtcacatca
gaatatcctgtaatcctctcctttgaaaatcactgcagcaaatatcaacagtacaagatg
tccaaatattgtgaagatctatttggggatctcctgttgaaacaagcacttgagtcacat
ccactcgaaccaggcaggcccttgccatccccgaatgacctcaaaagaaagatactcatc
aaaaacaaacgactgaaacctgaagttgagaaaaaacagcttgaagctttgaaaagcatg
atggaagctggagaatctgctgccccagctaacatcttggaggacgataatgaagaggag
atagaaaatgctgaccaagaggaagaagcacaccctgaatacaaatttggaaatgaactt
tctgctgatgacttgggtcataaggaggctgttgcaaatagcgtcaagaagggcctggtt
actgtagaagatgaacaagcgtggatggcctcttataaatatgtaggtgctaccactaat
atccatccctatttgtctacaatgatcaactacgcacagcctgtaaagtttcaaggtttc
catgtggctgaagaacgcaatattcattataacatgtcatcttttaatgagtcagttggt
cttggctacctgaagacacacgccattgaatttgtaaattataataaacggcaaatgagt
cgcatttaccccaagggaggtcgagtcgattccagtaattacatgcctcagattttctgg
aacgctggctgccagatggtttctctgaactatcaaaccccagatttagcgatgcaattg
aatcagggaaaatttgagtataatggatcatgcgggtaccttcttaaaccagatttcatg
agacgaccagatagaacctttgatcccttttctgaaactcctgttgacggagttattgca
gccacttgttcagtacaggtcatatcaggacagttcttatcagataagaaaatcggcact
tacgtagaagtggatatgtacgggttacccaccgacactatacgtaaagaattccgaact
cgcatggtcatgaacaatggactcaacccggtgtacaatgaagaatcatttgtatttcgg
aaggtgatcctgcctgacctggctgtcttgagaatagcagtgtacgatgacaacaacaag
ctgattggccagaggatcctgccactggatggcctccaagcaggctatcggcacatttcc
cttcgaaatgagggaaacaaaccattatcactgccaacaattttctgcaatatcgttctt
aaaacatacgtgcctgatggatttggagatattgtggatgctttatcagatccaaagaaa
tttctttcaattacggaaaagagagcagaccaaatgagagctatgggcattgaaactagt
gacatagccgatgtgcccagtgacacttccaagaatgacaagaaaggaaaggccaatact
gccaaagccaatgtgacccctcagagtagctctgagctcagaccaaccactacagctgct
atgggttctggtgtggaagccaaaaaaggtattgaacttatccctcaagtgaggatagaa
gatttaaagcagatgaaggcttacttgaagcatttaaagaaacagcagaaggagctaaat
tctttaaagaagaaacacgcaaaggagcacagtaccatgcagaagttacactgcacacaa
gtggacaaaatcgtggcacagtatgataaagagaagtcaactcatgagaaaaccctagag
aaggcgatgaagaagaaggggggaagtaattgtctcgaaatgaaaaaagaaacagaaatt
aaaattcagacactgacatcagatcacaaatctaaggtcaaagagattgtggcccagcat
acaaaagagtggtcagaaatgatcaacacccacagtgctgaggaacaagaaatccgggac
cttcacctgagtcagcaatgtgacctgctgaaaaagctgctcatcaacgcccacgagcag
caaacccagcaactgaaactgtcgcatgacagggaaaaaaaggaaatgcgggcacaccag
gctaagatttcgatggaaaatagcaaagccatcagccaagataaatctatcaagaataaa
gctgaacgggaaaggcgagtcagggagttaaacagcagcaacactaaaaagtttctggaa
gaaagaaagagacttgcaatgaaacagtccaaagaaatggatcagttgaaaaaagtccag
cttgaacatctagaattcctggagaaacagaatgagcagcttttgaaaacctgtcatgca
gtgtcccaaacgcaaggcgaaggagatgcagcagatggtgaaattggaagccgagatgga
ccgcagaccagcaacagtagtatgaaactccaaaatgcaaactaa

KEGG   Tupaia chinensis (Chinese tree shrew): 102477438
Entry
102477438         CDS       T02978                                 

Gene name
PLCB1
Definition
(RefSeq) phospholipase C beta 1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00562  Inositol phosphate metabolism
tup01100  Metabolic pathways
tup04015  Rap1 signaling pathway
tup04020  Calcium signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04062  Chemokine signaling pathway
tup04070  Phosphatidylinositol signaling system
tup04071  Sphingolipid signaling pathway
tup04072  Phospholipase D signaling pathway
tup04261  Adrenergic signaling in cardiomyocytes
tup04270  Vascular smooth muscle contraction
tup04310  Wnt signaling pathway
tup04371  Apelin signaling pathway
tup04540  Gap junction
tup04611  Platelet activation
tup04621  NOD-like receptor signaling pathway
tup04713  Circadian entrainment
tup04720  Long-term potentiation
tup04723  Retrograde endocannabinoid signaling
tup04724  Glutamatergic synapse
tup04725  Cholinergic synapse
tup04726  Serotonergic synapse
tup04728  Dopaminergic synapse
tup04730  Long-term depression
tup04742  Taste transduction
tup04750  Inflammatory mediator regulation of TRP channels
tup04911  Insulin secretion
tup04912  GnRH signaling pathway
tup04915  Estrogen signaling pathway
tup04916  Melanogenesis
tup04918  Thyroid hormone synthesis
tup04919  Thyroid hormone signaling pathway
tup04921  Oxytocin signaling pathway
tup04922  Glucagon signaling pathway
tup04924  Renin secretion
tup04925  Aldosterone synthesis and secretion
tup04926  Relaxin signaling pathway
tup04927  Cortisol synthesis and secretion
tup04928  Parathyroid hormone synthesis, secretion and action
tup04929  GnRH secretion
tup04933  AGE-RAGE signaling pathway in diabetic complications
tup04934  Cushing syndrome
tup04935  Growth hormone synthesis, secretion and action
tup04961  Endocrine and other factor-regulated calcium reabsorption
tup04970  Salivary secretion
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup04973  Carbohydrate digestion and absorption
tup05010  Alzheimer disease
tup05016  Huntington disease
tup05017  Spinocerebellar ataxia
tup05022  Pathways of neurodegeneration - multiple diseases
tup05142  Chagas disease
tup05143  African trypanosomiasis
tup05146  Amoebiasis
tup05163  Human cytomegalovirus infection
tup05200  Pathways in cancer
Module
tup_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102477438 (PLCB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102477438 (PLCB1)
   04310 Wnt signaling pathway
    102477438 (PLCB1)
   04371 Apelin signaling pathway
    102477438 (PLCB1)
   04020 Calcium signaling pathway
    102477438 (PLCB1)
   04070 Phosphatidylinositol signaling system
    102477438 (PLCB1)
   04072 Phospholipase D signaling pathway
    102477438 (PLCB1)
   04071 Sphingolipid signaling pathway
    102477438 (PLCB1)
   04022 cGMP-PKG signaling pathway
    102477438 (PLCB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102477438 (PLCB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102477438 (PLCB1)
   04621 NOD-like receptor signaling pathway
    102477438 (PLCB1)
   04062 Chemokine signaling pathway
    102477438 (PLCB1)
  09152 Endocrine system
   04911 Insulin secretion
    102477438 (PLCB1)
   04922 Glucagon signaling pathway
    102477438 (PLCB1)
   04929 GnRH secretion
    102477438 (PLCB1)
   04912 GnRH signaling pathway
    102477438 (PLCB1)
   04915 Estrogen signaling pathway
    102477438 (PLCB1)
   04921 Oxytocin signaling pathway
    102477438 (PLCB1)
   04926 Relaxin signaling pathway
    102477438 (PLCB1)
   04935 Growth hormone synthesis, secretion and action
    102477438 (PLCB1)
   04918 Thyroid hormone synthesis
    102477438 (PLCB1)
   04919 Thyroid hormone signaling pathway
    102477438 (PLCB1)
   04928 Parathyroid hormone synthesis, secretion and action
    102477438 (PLCB1)
   04916 Melanogenesis
    102477438 (PLCB1)
   04924 Renin secretion
    102477438 (PLCB1)
   04925 Aldosterone synthesis and secretion
    102477438 (PLCB1)
   04927 Cortisol synthesis and secretion
    102477438 (PLCB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102477438 (PLCB1)
   04270 Vascular smooth muscle contraction
    102477438 (PLCB1)
  09154 Digestive system
   04970 Salivary secretion
    102477438 (PLCB1)
   04971 Gastric acid secretion
    102477438 (PLCB1)
   04972 Pancreatic secretion
    102477438 (PLCB1)
   04973 Carbohydrate digestion and absorption
    102477438 (PLCB1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    102477438 (PLCB1)
  09156 Nervous system
   04724 Glutamatergic synapse
    102477438 (PLCB1)
   04725 Cholinergic synapse
    102477438 (PLCB1)
   04728 Dopaminergic synapse
    102477438 (PLCB1)
   04726 Serotonergic synapse
    102477438 (PLCB1)
   04720 Long-term potentiation
    102477438 (PLCB1)
   04730 Long-term depression
    102477438 (PLCB1)
   04723 Retrograde endocannabinoid signaling
    102477438 (PLCB1)
  09157 Sensory system
   04742 Taste transduction
    102477438 (PLCB1)
   04750 Inflammatory mediator regulation of TRP channels
    102477438 (PLCB1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102477438 (PLCB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102477438 (PLCB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102477438 (PLCB1)
   05016 Huntington disease
    102477438 (PLCB1)
   05017 Spinocerebellar ataxia
    102477438 (PLCB1)
   05022 Pathways of neurodegeneration - multiple diseases
    102477438 (PLCB1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102477438 (PLCB1)
   04934 Cushing syndrome
    102477438 (PLCB1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102477438 (PLCB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102477438 (PLCB1)
   05142 Chagas disease
    102477438 (PLCB1)
   05143 African trypanosomiasis
    102477438 (PLCB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tup04131]
    102477438 (PLCB1)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     102477438 (PLCB1)
Membrane trafficking [BR:tup04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    102477438 (PLCB1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    102477438 (PLCB1)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PI-PLC-Y PH_14 EF-hand_like DUF1154
Other DBs
NCBI-GeneID: 102477438
NCBI-ProteinID: XP_006150984
LinkDB
Position
Un
AA seq 1162 aa
MAGATILLILAPYLFVSAQCWRSMLRALDPKLRELLDVGNIGRLEHRMITVVYGPDLVNI
SHLNLVAFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNI
YRLFSADRKRVETALEACSLPSSRNDSIPQEDFTPDVYRVFLNNLCPRPEIDNIFSEFGA
KSKPYLTVDQMMDFINLKLRDPRLNEILYPPLKQEQVQVLIEKYEPNSSLAKKGQISVDG
FMRYLSGEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLL
SGCRCVELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENH
VDSPKQQAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSS
EGSGKKKLSEQASNTYSDSSSVFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEA
MATEEMSNLVNYIQPVKFESFEISKKRNKSFEMSSFVETKGLEQLTKSPVEFVEYNKMQL
SRIYPKGTRVDSSNYMPQLFWNAGCQMVALNFQTMDLAMQINMGMYEYNGKSGYRLKPEF
MRRPDKHFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFK
TKTSQGNAVNPVWEEEPIVFKKVVLPSLACLRIAVYEEGGKFIGHRILPVQAIRPGYHYI
CLRNERNQPLMLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLED
EEEVKKEADPGEAPSEAPSETRTTPAENGVNHTTSLTPKPPTQALHNQPAPGSVKAPAKT
EDLIQSVLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNE
IQNDYLRRRAALEKSAKKDSKKKSEPSSPDHGSSTIEQDLAALDAEMTQKLIDLKDKQQQ
QLLNLRQEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDK
KRQEKITEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLIEKHKEIRQQ
ILDEKPKLQMELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHGSAPPSLAMDPGKVN
HKPLASEEPEGDNPGKEFDTPL
NT seq 3489 nt   +upstreamnt  +downstreamnt
atggcaggtgccaccattttgcttattctagcaccctatctgtttgtcagtgctcagtgt
tggaggtctatgctgagagccttggaccccaagttacgtgaacttttggatgtggggaac
atcgggcgactggagcatcgcatgataacagtggtgtatgggcctgacctggttaacatt
tcccatttgaacctcgtcgctttccaagaagaagtggctaaggaatggacaaatgaagtt
ttcagtctggcaacaaacctgctggcccaaaacatgtccagggatgcgtttcttgaaaaa
gcctatactaaacttaagctgcaagtcactccagaggggcgcattcctctcaaaaacata
tatcgcttgttttcagcagaccggaaacgagttgaaactgctttagaggcttgtagtctt
ccatcttcaaggaatgattcaatacctcaagaagatttcactccagatgtgtatagagtt
ttcctgaacaacctttgccctcgaccagaaattgataacatcttttctgaatttggtgcc
aaaagcaaaccataccttacggtggatcagatgatggattttatcaatctgaagctgaga
gatccccggctaaatgaaatactgtacccacctctaaaacaggaacaggttcaagtattg
attgaaaaatatgagcccaatagtagcctcgccaaaaaagggcagatatcagtggatgga
tttatgcgctatctaagtggagaagaaaatggagtcgtttcacctgagaaactggattta
aatgaagacatgtctcaacccctttctcactatttcattaattcctcacacaacacctac
ctcacagctggccagttggctggaaactcctctgttgaaatgtatcgccaagtgctccta
tctggctgccgctgtgtggagctggactgctggaagggacggactgcagaagaagaacct
gtcatcacccatggattcactatgacaactgaaatatccttcaaggaagtcatagaagca
attgcggagtgcgcatttaagacttcaccttttccaattctcctttcatttgagaatcac
gtggattccccaaagcagcaagccaagatggcggagtactgccggctgatctttggggat
gccctcctcatggaaccgctggaaaaatacccgctggaatctggagtccctcttccaagc
cctatggacttaatgtataaaattttggtgaaaaataagaagaaatcacacaagtcatca
gagggaagtggtaaaaagaagctctcagaacaggcctccaacacgtacagcgactcctcc
agcgtgtttgagccctcatctccgggagctggggaagctgatacagagagtgacgatgac
gacgatgatgatgactgtaagaaatcttccatggatgaggggacagctgggagtgaggcc
atggccacagaagagatgtctaacctggtaaactacattcaaccagtcaagtttgagtca
tttgaaatttcaaaaaaaagaaataaaagctttgaaatgtcttccttcgtggaaaccaaa
ggacttgagcaacttacaaagtctccagtggaatttgtcgaatataacaaaatgcagctt
agcaggatatatccaaagggaacacgtgtggattcatccaactacatgcctcagctcttc
tggaatgcagggtgtcagatggtggcactcaatttccaaacaatggatctggccatgcaa
atcaatatgggcatgtatgaatacaatggaaagagcggctacagactgaagccagagttc
atgagaaggcccgacaagcattttgacccatttacagaaggcatcgtagacgggatagtg
gctaacactctctctgttaagattatttcaggtcagtttctttctgataagaaagtcggg
acttacgtggaagtggacatgtttggtttgcctgtggatacaaggaggaaggcatttaaa
accaagacatcacaaggaaatgctgtaaatcctgtctgggaggaagaacctattgtgttc
aaaaaggtggtccttccttctctggcctgtctaaggatagcagtttatgaagaaggaggt
aaatttatcggccatcggatcttgccagtgcaagccattcggccaggctatcactacatc
tgtctgagaaatgaaaggaaccagcccctgatgctgccagctgtctttgtctacatagaa
gtgaaggattatgtgccagatacgtatgcagatgtgattgaagctttgtcaaacccaatc
cgatacgtgaatctgatggagcagagggctaagcaactagctgctttgacactggaagat
gaagaagaggtaaagaaagaggctgatcccggggaagctccgtcagaggctcccagtgaa
accaggacgactccagcggaaaatggggtgaaccacaccacgtctttgacacccaaacca
cccacccaggctctgcacaatcaaccagcaccaggttctgtaaaggctcctgcaaaaaca
gaagatcttattcagagtgtcttaacagaagtggaagcacagactattgaagagctaaag
caacagaaatcctttgtgaaacttcaaaagaagcactacaaagaaatgaaagacctggtt
aagagacaccacaagaaaaccactgaccttatcaaagaacacactacaaaatacaatgaa
attcagaatgactacctgagaagaagagcagctttggaaaagagtgccaagaaggacagt
aagaaaaagtctgagcccagcagccctgaccatggctcatcaacaattgaacaagacctt
gctgccctagatgctgagatgacccaaaagttaatagacttgaaggacaaacaacagcag
cagctgcttaatcttcggcaagaacagtattatagtgaaaaataccagaagcgagaacat
attaaactgcttattcaaaagttgacggatgttgctgaagaatgtcagaacaatcaatta
aagaagctcaaagaaatctgtgagaaagagaagaaggaattgaagaagaaaatggataaa
aagaggcaggagaagataacagaagcaaaatccaaagacaaaagccagatggaagaggag
aagacagagatgatccgatcatatatccaggaggtagtgcagtacatcaagaggttagaa
gaagcgcaaagtaaacggcaagaaaaactcatagagaaacacaaggagatacgccagcag
atcctggatgaaaagcccaagctgcagatggagctggaacaagaataccaagacaagttc
aaaagactgcccctcgagattttggagtttgtgcaggaagcgatgaaagggaagatcagt
gaagacagcaatcatggttctgctcctccctctctggccatggaccctggaaaagtgaac
cataagcctcttgccagtgaggagcctgaaggagacaacccgggaaaagagtttgacact
cctctgtaa

KEGG   Tupaia chinensis (Chinese tree shrew): 102492903
Entry
102492903         CDS       T02978                                 

Gene name
PLCB2
Definition
(RefSeq) phospholipase C beta 2
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00562  Inositol phosphate metabolism
tup01100  Metabolic pathways
tup04015  Rap1 signaling pathway
tup04020  Calcium signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04062  Chemokine signaling pathway
tup04070  Phosphatidylinositol signaling system
tup04071  Sphingolipid signaling pathway
tup04072  Phospholipase D signaling pathway
tup04261  Adrenergic signaling in cardiomyocytes
tup04270  Vascular smooth muscle contraction
tup04310  Wnt signaling pathway
tup04371  Apelin signaling pathway
tup04540  Gap junction
tup04611  Platelet activation
tup04621  NOD-like receptor signaling pathway
tup04713  Circadian entrainment
tup04720  Long-term potentiation
tup04723  Retrograde endocannabinoid signaling
tup04724  Glutamatergic synapse
tup04725  Cholinergic synapse
tup04726  Serotonergic synapse
tup04728  Dopaminergic synapse
tup04730  Long-term depression
tup04742  Taste transduction
tup04750  Inflammatory mediator regulation of TRP channels
tup04911  Insulin secretion
tup04912  GnRH signaling pathway
tup04915  Estrogen signaling pathway
tup04916  Melanogenesis
tup04918  Thyroid hormone synthesis
tup04919  Thyroid hormone signaling pathway
tup04921  Oxytocin signaling pathway
tup04922  Glucagon signaling pathway
tup04924  Renin secretion
tup04925  Aldosterone synthesis and secretion
tup04926  Relaxin signaling pathway
tup04927  Cortisol synthesis and secretion
tup04928  Parathyroid hormone synthesis, secretion and action
tup04929  GnRH secretion
tup04933  AGE-RAGE signaling pathway in diabetic complications
tup04934  Cushing syndrome
tup04935  Growth hormone synthesis, secretion and action
tup04961  Endocrine and other factor-regulated calcium reabsorption
tup04970  Salivary secretion
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup04973  Carbohydrate digestion and absorption
tup05010  Alzheimer disease
tup05016  Huntington disease
tup05017  Spinocerebellar ataxia
tup05022  Pathways of neurodegeneration - multiple diseases
tup05142  Chagas disease
tup05143  African trypanosomiasis
tup05146  Amoebiasis
tup05163  Human cytomegalovirus infection
tup05200  Pathways in cancer
Module
tup_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102492903 (PLCB2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102492903 (PLCB2)
   04310 Wnt signaling pathway
    102492903 (PLCB2)
   04371 Apelin signaling pathway
    102492903 (PLCB2)
   04020 Calcium signaling pathway
    102492903 (PLCB2)
   04070 Phosphatidylinositol signaling system
    102492903 (PLCB2)
   04072 Phospholipase D signaling pathway
    102492903 (PLCB2)
   04071 Sphingolipid signaling pathway
    102492903 (PLCB2)
   04022 cGMP-PKG signaling pathway
    102492903 (PLCB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102492903 (PLCB2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102492903 (PLCB2)
   04621 NOD-like receptor signaling pathway
    102492903 (PLCB2)
   04062 Chemokine signaling pathway
    102492903 (PLCB2)
  09152 Endocrine system
   04911 Insulin secretion
    102492903 (PLCB2)
   04922 Glucagon signaling pathway
    102492903 (PLCB2)
   04929 GnRH secretion
    102492903 (PLCB2)
   04912 GnRH signaling pathway
    102492903 (PLCB2)
   04915 Estrogen signaling pathway
    102492903 (PLCB2)
   04921 Oxytocin signaling pathway
    102492903 (PLCB2)
   04926 Relaxin signaling pathway
    102492903 (PLCB2)
   04935 Growth hormone synthesis, secretion and action
    102492903 (PLCB2)
   04918 Thyroid hormone synthesis
    102492903 (PLCB2)
   04919 Thyroid hormone signaling pathway
    102492903 (PLCB2)
   04928 Parathyroid hormone synthesis, secretion and action
    102492903 (PLCB2)
   04916 Melanogenesis
    102492903 (PLCB2)
   04924 Renin secretion
    102492903 (PLCB2)
   04925 Aldosterone synthesis and secretion
    102492903 (PLCB2)
   04927 Cortisol synthesis and secretion
    102492903 (PLCB2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102492903 (PLCB2)
   04270 Vascular smooth muscle contraction
    102492903 (PLCB2)
  09154 Digestive system
   04970 Salivary secretion
    102492903 (PLCB2)
   04971 Gastric acid secretion
    102492903 (PLCB2)
   04972 Pancreatic secretion
    102492903 (PLCB2)
   04973 Carbohydrate digestion and absorption
    102492903 (PLCB2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    102492903 (PLCB2)
  09156 Nervous system
   04724 Glutamatergic synapse
    102492903 (PLCB2)
   04725 Cholinergic synapse
    102492903 (PLCB2)
   04728 Dopaminergic synapse
    102492903 (PLCB2)
   04726 Serotonergic synapse
    102492903 (PLCB2)
   04720 Long-term potentiation
    102492903 (PLCB2)
   04730 Long-term depression
    102492903 (PLCB2)
   04723 Retrograde endocannabinoid signaling
    102492903 (PLCB2)
  09157 Sensory system
   04742 Taste transduction
    102492903 (PLCB2)
   04750 Inflammatory mediator regulation of TRP channels
    102492903 (PLCB2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102492903 (PLCB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102492903 (PLCB2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102492903 (PLCB2)
   05016 Huntington disease
    102492903 (PLCB2)
   05017 Spinocerebellar ataxia
    102492903 (PLCB2)
   05022 Pathways of neurodegeneration - multiple diseases
    102492903 (PLCB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102492903 (PLCB2)
   04934 Cushing syndrome
    102492903 (PLCB2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102492903 (PLCB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102492903 (PLCB2)
   05142 Chagas disease
    102492903 (PLCB2)
   05143 African trypanosomiasis
    102492903 (PLCB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tup04131]
    102492903 (PLCB2)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     102492903 (PLCB2)
Membrane trafficking [BR:tup04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    102492903 (PLCB2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    102492903 (PLCB2)
SSDB
Motif
Pfam: PLC-beta_C PI-PLC-X PH_14 PI-PLC-Y EF-hand_like C2 UvrD-helicase Gp58
Other DBs
NCBI-GeneID: 102492903
NCBI-ProteinID: XP_006158762
LinkDB
Position
Un
AA seq 1197 aa
MSLLNPVLLPPKVPAYLSQGERFIKWDDETAIASPVILRVDPKGYYLYWTYQSKEMEFLD
ITSIRDTRFGKFAKMPKSQKLREVFNMEFPDNNFXXXXXKTLTVVSGPDMVDLTFHNFVS
YKENVGKNWAEDVLALVKHPLTANAPRSTFLDKILVKLKMQLNPEGKIPVKNLFQMFLLX
XXXLPADRKRVEAALSACHLPKGKNDAINPEDFPESVYKSFLMNLCPRPEIDEIFTSYHS
KAKPYMTKEHLTKFINQKQRDSRLNSLLFPPARPDQVQGLIDKYEPSGINVQRGQLSPEG
MVWFLCGPENSVLAQDKLLLHHDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLL
SGCRCVELDCWKGKPPDEEPIITHGFTMTTDIFFKEAIEAIAESAFKTSPYPVILSFENH
VDSPRQQAKMAEYCRTMFGDMLLTEPLEKFPLKPGVPLPSPEDLRGKILIKNKKNQFSGP
AAPSKEAGGEAEGSCPPSAPASEDTVWAGEEGTEPEEEEVDEEEEEEESGSLDEEEIKKM
QSDEGTAGLEVTAYEEMSSLVNYIQPTKFISFEFSAQKNRSYVISSFTELKAYDLLSKAS
VQFVDYNKRQMSRIYPKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLPMQQNMALFEFN
GQSGYLLKHEFMRRPDKQFNPFSVDRIDVVVATTLSITVISGQFLSERSVRTYVEVELFG
LPGDPKRRYRTKMSPSTNSINPVWKEEPFVFEKILMPELASLRVAVMEEGNRFLGHRIIP
INALSSGYHHLCLHSESNMPLTMPALFVFLEMKDYVPDTWADLTVALANPIKFFSAHDKK
SVKLKEAMGGLPEKPFSPRSPVLDQVNGALAPMSNGSAAAGAKAKEEATKKTDEPRTASL
QEVRELKAAVKLQRRHEKELRELERRCARRWEELLQRGAAQLAELAPPGAGVGGGGRKLC
PGKGSRKKRSQPGEEPAGTALGEGSEGTDARVKELRDRLELELLQLGGEQCESVLKRKEQ
HVAEQISKMMELAREKQAAELKTLKETSETDTKEMKKKLEAKRLERIQAMTKATTDKMAQ
ERLKREINNSHIQEVVQVIKQLTESLERQQEKLEEKQAACLEQIQEMEKQFQQEVQSEYE
ARMKGLEAEVKESVRACLRACFLPEAEDKPERPCEASREQSEQDPLTAKADAQESHL
NT seq 3594 nt   +upstreamnt  +downstreamnt
atgtctctgctcaaccctgtcctgctgcctcccaaggtgccggcctatctgagccaaggg
gagcgcttcatcaaatgggacgatgaaacggcaatagcctccccagtaatcctccgtgtg
gatcccaagggctattacttatactggacatatcagagtaaggagatggagtttctggat
atcaccagcatccgggatacccgctttgggaagtttgccaagatgcccaagagccagaag
ctccgagaggtcttcaacatggagtttcctgacaacaacttcnnnnnnnnnnnnntgaag
accctcacggtggtgtccggccctgacatggtggacctcaccttccacaacttcgtctcc
tacaaggagaacgtgggcaagaactgggctgaggacgtgctggccctggtcaagcaccca
ctgacagccaatgccccccgcagcaccttcctggacaagatcctggtgaagctcaaaatg
cagctcaacccagaagggaagattcctgtgaagaatcttttccagatgtttcttctgnnn
nnnnnnnggttgcctgctgaccgcaagcgggtggaagctgctctcagcgcctgccacctc
ccgaaaggcaaaaacgatgccatcaatcctgaggacttcccagaatctgtctacaagagt
ttcctcatgaacctctgtcctcggccagaaatagacgagatctttacttcctaccattct
aaggccaagccctacatgaccaaggagcacttgaccaaattcatcaaccagaaacagcga
gactcaagactcaactccctgctgttcccgccagcacggcctgaccaggtgcaaggtctc
atcgacaagtacgagcccagtggcatcaatgtgcagaggggccagctgtcacctgagggc
atggtctggtttctctgtgggccagagaacagtgtgctggcccaggacaagctgctactc
caccacgacatgacgcagcccctcaatcattacttcatcaactcctcacataacacctac
ctgacagccggccagttctcaggcctttcctcggcggagatgtaccgccaggtgctgctg
tctggctgccgttgtgtggagctggactgctggaaggggaagccccccgacgaggagccc
atcatcacccacggcttcaccatgaccacagacatcttcttcaaggaagccatcgaagct
attgcagagagtgccttcaagacctccccctatcccgtcatcctgtcctttgaaaaccac
gtggactcaccccgccagcaggctaagatggctgagtactgccgaaccatgtttggggac
atgctccttacagagcccctggaaaagttcccactgaaacctggagtcccgctgcccagc
ccagaggatctccggggcaagatcctcatcaagaacaagaagaaccagttttctggtcca
gcagcccccagcaaggaggctgggggagaggctgagggcagctgcccacccagtgcccct
gccagcgaggacacagtgtgggctggcgaggaagggactgagccagaggaggaggaggta
gacgaggaggaggaggaggaagagtcaggaagcctggatgaagaagagataaagaagatg
cagtcggacgagggcaccgcgggcctagaggtgacagcttacgaggagatgtccagccta
gtcaattacattcagcccaccaagttcatctccttcgagttctctgcccagaagaaccga
agttacgtcatctcctccttcacagagctcaaggcttatgatctgctttccaaggcctca
gtgcagtttgtggactacaacaagcgccagatgagccgcatctaccccaagggtacccgc
atggactcctccaactacatgccccagatgttctggaatgccggatgccagatggtcgcc
ctgaacttccagacaatggacctgcccatgcaacagaacatggcgctgtttgagttcaac
gggcagagtggctacctcctcaagcatgagttcatgcgccgtccggacaagcagttcaat
cccttctcggtggaccgcatcgacgtggtggtggccaccaccctttccattacggtaatc
tctgggcagttcctgtcagaacgcagtgtacgcacctatgtggaagtggagctgtttggc
cttcctggggacccgaagaggcgctatcgcaccaagatgtcacctagtacgaactccatc
aatcctgtatggaaagaggagccctttgtcttcgagaagatcttgatgcctgagctggcc
tccctcagggtggctgtcatggaggaaggcaacaggttcctcggacaccgcatcatcccc
atcaatgccctcagttccgggtaccaccacctgtgcttgcacagcgagagcaacatgccc
ctcaccatgcccgcgctctttgtcttcctggagatgaaggactatgtacctgacacctgg
gcagatctcaccgtggccctggccaaccccatcaagttcttcagtgcccatgataagaag
tcggtgaagctcaaggaagccatgggcggtctccctgagaagcccttctcacccaggagc
ccagttctggaccaggtcaatggggcactggccccgatgagtaatgggtcagcagcagct
ggggccaaggccaaggaggaggccacaaaaaaaactgacgagccacggaccgccagcctg
caggaggtgcgggagctgaaggcagctgtgaagctgcagcggcggcacgagaaggagctg
cgggagctggagcggcgctgcgcgcggcgctgggaggagctgctgcagcgaggcgcagcg
cagctggcagagctcgcgcctccgggcgcgggggtcggcggcgggggccgcaagctctgt
cccggcaagggatcgcgcaagaaaagaagccagcctggcgaggagcctgctgggaccgca
ctgggcgagggctccgagggcacagacgcgcgcgtgaaggagctgagggacaggctggag
ctggagctgctgcagctcggcggggagcagtgtgagagcgtcctgaagcgcaaggagcag
cacgtggctgagcaaatctccaaaatgatggagctggccagggagaaacaggcggcagaa
ctgaaaaccctcaaggaaacctcagagactgacaccaaagagatgaagaaaaagctggaa
gccaagaggctggagcggatccaagccatgaccaaagccaccacagacaagatggcccag
gagaggttgaagagagagattaacaactcccacatccaggaagtggtacaggtcatcaag
cagctgacagagagcctggagaggcagcaggagaagctggaagagaagcaggcggcctgc
ctggaacagatccaggagatggaaaagcagttccagcaggaggtgcagtcagagtacgag
gccaggatgaagggcctggaggccgaggtgaaggagtcagtgagggcctgcctcagagcc
tgcttcctccctgaggccgaggacaagccagagagaccctgtgaggcctccagggagcag
agtgagcaggacccactcacagcaaaggcggatgcccaggagagccacctctga

DBGET integrated database retrieval system