KEGG   Tupaia chinensis (Chinese tree shrew): 102472614
Entry
102472614         CDS       T02978                                 

Gene name
DDB2
Definition
(RefSeq) damage specific DNA binding protein 2
  KO
K10140  DNA damage-binding protein 2
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup03420  Nucleotide excision repair
tup04115  p53 signaling pathway
tup04120  Ubiquitin mediated proteolysis
tup05161  Hepatitis B
tup05169  Epstein-Barr virus infection
tup05200  Pathways in cancer
tup05202  Transcriptional misregulation in cancer
tup05210  Colorectal cancer
tup05212  Pancreatic cancer
tup05213  Endometrial cancer
tup05214  Glioma
tup05216  Thyroid cancer
tup05217  Basal cell carcinoma
tup05218  Melanoma
tup05220  Chronic myeloid leukemia
tup05222  Small cell lung cancer
tup05223  Non-small cell lung cancer
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102472614 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    102472614 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102472614 (DDB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102472614 (DDB2)
   05202 Transcriptional misregulation in cancer
    102472614 (DDB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102472614 (DDB2)
   05212 Pancreatic cancer
    102472614 (DDB2)
   05225 Hepatocellular carcinoma
    102472614 (DDB2)
   05226 Gastric cancer
    102472614 (DDB2)
   05214 Glioma
    102472614 (DDB2)
   05216 Thyroid cancer
    102472614 (DDB2)
   05220 Chronic myeloid leukemia
    102472614 (DDB2)
   05217 Basal cell carcinoma
    102472614 (DDB2)
   05218 Melanoma
    102472614 (DDB2)
   05213 Endometrial cancer
    102472614 (DDB2)
   05224 Breast cancer
    102472614 (DDB2)
   05222 Small cell lung cancer
    102472614 (DDB2)
   05223 Non-small cell lung cancer
    102472614 (DDB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102472614 (DDB2)
   05169 Epstein-Barr virus infection
    102472614 (DDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:tup04121]
    102472614 (DDB2)
   03400 DNA repair and recombination proteins [BR:tup03400]
    102472614 (DDB2)
Ubiquitin system [BR:tup04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     102472614 (DDB2)
DNA repair and recombination proteins [BR:tup03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      102472614 (DDB2)
SSDB
Motif
Pfam: WD40 T2SSG Ge1_WD40
Other DBs
NCBI-GeneID: 102472614
NCBI-ProteinID: XP_006157865
UniProt: L9JER7
LinkDB
Position
Un
AA seq 427 aa
MAPRKRPETQKTCEVVLRPRSKRSRSPQELEPEAKKLSGKGSGSSRRHDSDGLWEGLASQ
QVPPPCSSIVKAIDQYKLGRATWPSLQQGLQQSFSNSLASYRIFQKAAPFDRRATSLAWH
PTHPSTLAVGSKGGDILLWNFGIKDTPTFIKGIGAGGSITGMKFNPLNTDQFFTSSMEGM
TRLQDFKGNVLRVFTTSDNCNVWFCSLDVSAKSRMVVTGDNVGNVVLLNMDGKELWNLRM
HKKKVTHVALNPCCDWLLATASVDQTVKLWDLRQVRGKASFLSSLPHRHPVNAASFSPDG
ARLLTTDQKNEIRVYSASQWECPLGLIPHPHRHFQHLTPIKAAWHPRYNLIVVGRYPDPN
FKSCNPYELRTIDVFDGSSGKMMCQLYDPESSGIISLNEFNPMGDTLASAMGYHILIWSR
EEAGTQK
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggctcccaggaaacgcccagaaacccagaagacctgtgaggttgtgttacgccccagg
agcaagaggagcagaagtccccaggagctggagcccgaggccaagaagctcagtgggaag
ggctccggttccagcagaagacatgactcagacggcctttgggaggggttggctagccag
caggtcccgccaccatgcagcagcatcgtcaaggccatcgaccagtataagctgggcaga
gccacctggccgtcgctgcagcagggtctccagcagtccttttcaaactctctggcttcc
taccggatattccaaaaggccgccccctttgacaggagggctacatccttggcgtggcac
ccgactcaccccagcaccctggctgtgggatccaaagggggagatatcttgctctggaat
tttggaataaaggatacacctaccttcattaaagggattggagctggagggagcatcact
gggatgaagtttaaccctcttaataccgaccagtttttcacctcctccatggagggaatg
actcggctgcaagactttaaaggcaacgttctccgtgttttcaccacctcagacaactgc
aacgtctggttttgcagcctggatgtgtctgccaaaagccgaatggtggtcacgggagac
aacgtgggaaatgtggtcctgctgaacatggacggcaaggagctttggaatctcagaatg
cacaaaaagaaagtcacgcatgtggccctgaacccatgctgtgattggctcctggccacg
gcctccgtagatcaaacagtgaaactctgggacctgcgccaggttagagggaaagccagc
ttcctgtcctcgctgccgcacaggcatcctgtcaacgcagcttctttcagtcctgatgga
gcccggctcctgaccacagaccagaagaatgagatccgggtttactctgcctcccagtgg
gagtgccccctgggcctgatcccgcaccctcaccggcacttccagcacctcacacccatc
aaggcagcctggcatcctcggtacaacctcattgtcgtgggccgatacccagatcctaat
ttcaaaagttgtaacccctacgaattaaggacgattgatgtgtttgatggcagctccgga
aagatgatgtgccagctctatgacccagaatcttctgggatcatctcgctcaatgagttc
aatcccatgggggacaccctggcctcggcaatgggttatcacatcctcatttggagccgg
gaggaagctgggacacagaagtga

DBGET integrated database retrieval system