KEGG   Tupaia chinensis (Chinese tree shrew): 102472740
Entry
102472740         CDS       T02978                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta 1
  KO
K02105  catenin beta 1
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04015  Rap1 signaling pathway
tup04310  Wnt signaling pathway
tup04390  Hippo signaling pathway
tup04510  Focal adhesion
tup04520  Adherens junction
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04670  Leukocyte transendothelial migration
tup04916  Melanogenesis
tup04919  Thyroid hormone signaling pathway
tup04934  Cushing syndrome
tup05010  Alzheimer disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05100  Bacterial invasion of epithelial cells
tup05132  Salmonella infection
tup05160  Hepatitis C
tup05163  Human cytomegalovirus infection
tup05165  Human papillomavirus infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05200  Pathways in cancer
tup05205  Proteoglycans in cancer
tup05210  Colorectal cancer
tup05213  Endometrial cancer
tup05215  Prostate cancer
tup05216  Thyroid cancer
tup05217  Basal cell carcinoma
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
tup05412  Arrhythmogenic right ventricular cardiomyopathy
tup05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102472740 (CTNNB1)
   04310 Wnt signaling pathway
    102472740 (CTNNB1)
   04390 Hippo signaling pathway
    102472740 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102472740 (CTNNB1)
   04520 Adherens junction
    102472740 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102472740 (CTNNB1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    102472740 (CTNNB1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102472740 (CTNNB1)
   04916 Melanogenesis
    102472740 (CTNNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102472740 (CTNNB1)
   05205 Proteoglycans in cancer
    102472740 (CTNNB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102472740 (CTNNB1)
   05225 Hepatocellular carcinoma
    102472740 (CTNNB1)
   05226 Gastric cancer
    102472740 (CTNNB1)
   05216 Thyroid cancer
    102472740 (CTNNB1)
   05217 Basal cell carcinoma
    102472740 (CTNNB1)
   05215 Prostate cancer
    102472740 (CTNNB1)
   05213 Endometrial cancer
    102472740 (CTNNB1)
   05224 Breast cancer
    102472740 (CTNNB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102472740 (CTNNB1)
   05022 Pathways of neurodegeneration - multiple diseases
    102472740 (CTNNB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102472740 (CTNNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102472740 (CTNNB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102472740 (CTNNB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102472740 (CTNNB1)
   05100 Bacterial invasion of epithelial cells
    102472740 (CTNNB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102472740 (CTNNB1)
   05163 Human cytomegalovirus infection
    102472740 (CTNNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102472740 (CTNNB1)
   05165 Human papillomavirus infection
    102472740 (CTNNB1)
SSDB
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 102472740
NCBI-ProteinID: XP_014445951
LinkDB
Position
Un
AA seq 781 aa
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTS
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSXXXPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggctactcaagctgatttgatggaattggacatggccatggagccagacagaaaagcg
gctgtgagtcactggcagcaacaatcttacctggactctgggatccattctggtgccact
accacagcaccttctctcagtggtaaaggcaatcctgaggaagaggatgtggatacctcc
caagtcttgtatgagtgggaacagggattttctcagtccttcactcaagaacaagtagct
gatattgatggacagtatgcaatgacacgagctcagagggtacgagctgctatgttccct
gagacgttagatgagggtatgcaaatcccatctacacagtttgatgctgctcatcccact
aacgtccagcgtttggctgaaccatcacaaatgctgaaacatgccgttgtaaacttgatt
aactatcaagatgatgcagaacttgccacacgtgcgatccctgaactgacaaaactgcta
aatgacgaggaccaggtggtagttaataaggctgcagttatggtccatcagctttctaaa
aaagaagcttccagacatgccatcatgcgttctcctcagatggtgtctgctattgtacgt
accatgcagaatacaaatgacgtggaaacagctcgttgcactgctgggaccttgcacaac
ctttcccatcatcgtgaggggttgttggccatctttaaatcnnnnnnnnnncctgccctg
gtgaaaatgcttggttcaccagtggattctgtattgttttatgccatcacaactctccac
aaccttttattacatcaagaaggagctaaaatggctgtgcgtttagctggtgggctgcag
aaaatggttgctttgctcaacaaaacaaatgttaagttcctggctattacaacagactgc
cttcagattttagcttatggaaatcaagaaagcaagttgatcattctagctagtggtgga
ccccaagctttggtaaatataatgaggacctacacttatgagaaactattgtggaccaca
agcagagtactgaaggtgctgtctgtctgctctagtaataaaccggctattgtagaagct
ggcgggatgcaagctttaggacttcacctgacagatcccagtcaacgtcttgttcagaac
tgtctttggactcttaggaatctttcagatgctgcaactaaacaggaagggatggaaggt
ctccttgggactcttgttcagcttctgggttcagatgatataaatgtggtcacctgtgca
gctggaattctttctaatctcacctgcaataattacaagaataagatgatggtgtgccaa
gtgggtggtattgaggcgcttgtgcgtactgtccttcgtgctggcgacagggaggacatc
actgagcctgccatttgtgctcttcgtcatctcaccagccgacaccaagaggcagagatg
gcccagaatgctgttcgccttcactacggactaccagttgtggttaaactcctacaccca
ccatcccattggcctcttataaaggctactgttggattgattcgaaatcttgccctttgt
ccagcaaatcatgcacctttgcgtgagcagggtgctattccacggctagttcagctgctt
gtccgtgcacatcaggatacccagcgtcgtacatccatgggtggtacacaacagcagttt
gtggagggggtccgcatggaagaaatagttgaaggttgtactggagcccttcacattcta
gctcgtgatgttcacaaccgaattgtaatcagaggactgaacaccattcctctgtttgtg
cagctgctttattctcccattgaaaatatccagagagtagctgcaggggtcctctgtgaa
cttgctcaagacaaggaggctgcagaggctattgaggccgagggagctacagctcctctc
acagaattactccactccaggaacgaaggtgtagccacatatgcagctgctgttttgttc
cgaatgtctgaggacaagccacaggattacaagaaacggctctcggttgagctgaccagt
tctctcttcagaacagagccgatggcttggaacgagactgctgatcttggacttgatatt
ggcgcccagggagagcctcttggatatcgccaggatgatcccagctaccgttcatttcac
tctggtggatatggccaggatgccttgggtatggaccccatgatggagcatgagatgggt
ggccaccaccctggtgctgactatccagttgatgggctgccagatctggggcatgcccag
gacctcatggatgggctacctccaggcgacagcaatcagctggcctggtttgatactgac
ctgtaa

DBGET integrated database retrieval system