KEGG   Tupaia chinensis (Chinese tree shrew): 102472810
Entry
102472810         CDS       T02978                                 

Gene name
TCF7L2
Definition
(RefSeq) transcription factor 7 like 2
  KO
K04491  transcription factor 7-like 2
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04310  Wnt signaling pathway
tup04390  Hippo signaling pathway
tup04520  Adherens junction
tup04916  Melanogenesis
tup04934  Cushing syndrome
tup05132  Salmonella infection
tup05165  Human papillomavirus infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05200  Pathways in cancer
tup05210  Colorectal cancer
tup05213  Endometrial cancer
tup05215  Prostate cancer
tup05216  Thyroid cancer
tup05217  Basal cell carcinoma
tup05221  Acute myeloid leukemia
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
tup05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102472810 (TCF7L2)
   04390 Hippo signaling pathway
    102472810 (TCF7L2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102472810 (TCF7L2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102472810 (TCF7L2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102472810 (TCF7L2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102472810 (TCF7L2)
   05225 Hepatocellular carcinoma
    102472810 (TCF7L2)
   05226 Gastric cancer
    102472810 (TCF7L2)
   05216 Thyroid cancer
    102472810 (TCF7L2)
   05221 Acute myeloid leukemia
    102472810 (TCF7L2)
   05217 Basal cell carcinoma
    102472810 (TCF7L2)
   05215 Prostate cancer
    102472810 (TCF7L2)
   05213 Endometrial cancer
    102472810 (TCF7L2)
   05224 Breast cancer
    102472810 (TCF7L2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102472810 (TCF7L2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102472810 (TCF7L2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102472810 (TCF7L2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    102472810 (TCF7L2)
   05165 Human papillomavirus infection
    102472810 (TCF7L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tup03000]
    102472810 (TCF7L2)
Transcription factors [BR:tup03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    102472810 (TCF7L2)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 102472810
NCBI-ProteinID: XP_006162832
LinkDB
Position
Un
AA seq 529 aa
MIEHQIAIQYLQMKWPLLDVQAGSLQSRQALKDARSPSPAHIVGPLPCCTQGHDCQHFCP
PSDFTVSTQVFRDMKRSYSLQKVGEPWCMESNKVPVVQHPHHVHPLTPLITYSNEHFTPG
NPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTG
GFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSS
KHQDSKKEEEKKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSRE
EQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETNEHSECFLNPCLSLPP
ITDLSAPKKCRARFGLDQQNNWCGPCRRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPPSP
HLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLLAEATHGKASALCPNGAL
DLPPAALQPPIVPSSSLAQPSTSSLHSHNSLAGTQPQPQPLSLVTKSLE
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgattgaacaccagattgcaattcagtatctccagatgaaatggccactgcttgatgtc
caggcagggagcctccagagtagacaagccctcaaggatgcccggtccccatcaccggca
cacattgtcggccccctcccttgctgcactcagggacatgactgtcagcacttctgcccc
ccctcagacttcactgtcagcactcaagtcttcagggacatgaaaaggagctactcctta
caaaaggttggggagccctggtgtatggagtcgaacaaagtgccggtggtgcagcaccct
caccatgtccaccccctcacgcctcttatcacgtacagcaatgaacacttcaccccggga
aacccacctccacacttaccagccgacgtagaccccaaaacaggcatcccacggcctccg
caccctccagatatatctccgtattacccactatcgcccggcaccgtaggacaaatcccc
catccgctaggatggttagtaccacagcaaggtcagccggtgtacccaatcacgacagga
ggattcagacacccctaccccacagctctgactgtcaacgcttccatgtccaggttccct
ccccatatggtcccaccacatcatactctacacacgaccggcatcccccatccggccata
gtcacaccaacagttaaacaggaatcctcccagagtgacgtcggctcactccatagctca
aagcatcaggactccaaaaaggaagaagaaaagaagaaaccccacataaagaaacctctt
aatgcattcatgttgtatatgaaggaaatgagggcaaaggtcgtagctgagtgcacattg
aaagaaagcgcggccatcaaccagatcctcgggcgaaggtggcatgcactgtccagagaa
gagcaagcgaaatactacgagctggcccggaaggagcgacagcttcacatgcagctgtac
cccggctggtccgcgcgggataactatgggaagaagaagaagaggaaaagggacaagcag
ccgggagagaccaatgaacacagcgaatgtttcctaaatccttgcctttcacttcctccg
attacagacctgagcgctcctaagaaatgccgagcgcgctttggccttgatcaacagaat
aactggtgcggcccttgcaggagaaaaaaaaagtgcgttcgctacatacaaggtgaaggc
agctgcctcagcccaccctcttcagatggaagcttactagattcgcctcctccctccccc
cacctgctaggctcccctccgcgcgacgccaagtcacagactgagcagacccagcctctc
tcgctgtccctgaagcccgatcccctggcccacctctccatgatgcctccgccgcccgct
ctcctgcttgccgaggccacccatggcaaggcctctgccctctgtcccaacggggccctg
gacctgcctcccgccgctctgcagcctcccatcgtcccctcctcatcacttgcacagccg
tcaacatcttccttacattcccacaactctctggccgggacccagccccagccccagccg
ctgtccctcgtcaccaagtctttagaatag

KEGG   Tupaia chinensis (Chinese tree shrew): 102474621
Entry
102474621         CDS       T02978                                 

Gene name
LEF1
Definition
(RefSeq) lymphoid enhancer binding factor 1
  KO
K04492  lymphoid enhancer-binding factor 1
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04310  Wnt signaling pathway
tup04390  Hippo signaling pathway
tup04520  Adherens junction
tup04916  Melanogenesis
tup04934  Cushing syndrome
tup05132  Salmonella infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05200  Pathways in cancer
tup05210  Colorectal cancer
tup05213  Endometrial cancer
tup05215  Prostate cancer
tup05216  Thyroid cancer
tup05217  Basal cell carcinoma
tup05221  Acute myeloid leukemia
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
tup05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102474621 (LEF1)
   04390 Hippo signaling pathway
    102474621 (LEF1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102474621 (LEF1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102474621 (LEF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102474621 (LEF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102474621 (LEF1)
   05225 Hepatocellular carcinoma
    102474621 (LEF1)
   05226 Gastric cancer
    102474621 (LEF1)
   05216 Thyroid cancer
    102474621 (LEF1)
   05221 Acute myeloid leukemia
    102474621 (LEF1)
   05217 Basal cell carcinoma
    102474621 (LEF1)
   05215 Prostate cancer
    102474621 (LEF1)
   05213 Endometrial cancer
    102474621 (LEF1)
   05224 Breast cancer
    102474621 (LEF1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102474621 (LEF1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102474621 (LEF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102474621 (LEF1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    102474621 (LEF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tup03000]
    102474621 (LEF1)
Transcription factors [BR:tup03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    102474621 (LEF1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 102474621
NCBI-ProteinID: XP_006162294
LinkDB
Position
Un
AA seq 413 aa
MPQLSGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNES
EIIPASNGHEVARQAQASQESYHDKAREHSDDGKHPDGGLYGKGPSYSSYSGYIMMPNMN
NDPYMPNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPAHLPSDVNAK
QGMSRHPPAPDMPTFYPLSPGGVGQITPPLGWQGQPVYPVTGGFRQPYPSSLSVDTSVPR
FSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDGDLMHVKPQHEQRKEQEPKRPHIKK
PLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQ
LYPGWSARDNYGKKKKRKREKLQESASGGKRSSFPTCKAKAAAPGPLLEMEAC
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgccccagctctccgggggaggcggcggcgggggggacccggaactgtgcgccacggac
gagatgatccccttcaaggacgagggcgatccccagaaagagaagatcttcgccgagatc
agccaccctgaagaggaaggcgacttggccgacatcaagtcgtctttggttaacgagtcc
gaaatcatcccggccagcaacgggcacgaggtggccagacaagcccaagcctcacaggag
tcctaccacgacaaggccagagaacactccgatgacggcaaacatccagatggaggcctc
tacggcaaggggccctcctactcgagctattctgggtacataatgatgccaaatatgaac
aacgacccgtacatgcccaatggatcgctctccccacccatcccgcgaacatcgaacaag
gtgcccgtggtgcagccgtcccatgcggtccaccctctcacgcccctcatcacctacagc
gacgagcacttttctccaggatcacacccagcacacctcccatccgacgtcaacgccaag
caaggcatgtccagacatccccccgctcccgacatgcccaccttttaccccctgtctcca
ggcggcgtgggacagatcaccccacctcttggctggcaagggcagcctgtataccccgtc
acgggtggattcaggcaaccctatccgtcctcactgtcagtcgacacttccgtgcccagg
ttttcccatcacatgatccctggccctcccggtccccacacaaccggcatccctcacccc
gccatcgtaacgcctcaggtcaaacaggagcacccccacacggacggcgacctaatgcac
gtgaagcctcagcacgaacagagaaaggagcaggagccaaaaagacctcacattaagaag
cctctgaacgcttttatgttatacatgaaagagatgagagcgaacgtcgtagccgagtgc
accctcaaggagagcgcggccatcaaccagatcttgggcaggaggtggcacgccctctcc
cgtgaagaacaggcgaaatactacgaattagcacggaaagaaagacagctacacatgcag
ctctacccgggctggtccgcgcgggacaactacggtaagaagaagaagaggaagagagag
aagctccaggaatccgcgtcaggtggaaagagaagctcgttcccaacgtgcaaagccaag
gcagcggccccaggacctcttctggagatggaagcttgttga

KEGG   Tupaia chinensis (Chinese tree shrew): 102481394
Entry
102481394         CDS       T02978                                 

Gene name
TCF7L1
Definition
(RefSeq) transcription factor 7 like 1
  KO
K04490  transcription factor 7-like 1
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04310  Wnt signaling pathway
tup04390  Hippo signaling pathway
tup04520  Adherens junction
tup04916  Melanogenesis
tup04934  Cushing syndrome
tup05132  Salmonella infection
tup05165  Human papillomavirus infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05200  Pathways in cancer
tup05210  Colorectal cancer
tup05213  Endometrial cancer
tup05215  Prostate cancer
tup05216  Thyroid cancer
tup05217  Basal cell carcinoma
tup05221  Acute myeloid leukemia
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
tup05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102481394 (TCF7L1)
   04390 Hippo signaling pathway
    102481394 (TCF7L1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102481394 (TCF7L1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102481394 (TCF7L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102481394 (TCF7L1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102481394 (TCF7L1)
   05225 Hepatocellular carcinoma
    102481394 (TCF7L1)
   05226 Gastric cancer
    102481394 (TCF7L1)
   05216 Thyroid cancer
    102481394 (TCF7L1)
   05221 Acute myeloid leukemia
    102481394 (TCF7L1)
   05217 Basal cell carcinoma
    102481394 (TCF7L1)
   05215 Prostate cancer
    102481394 (TCF7L1)
   05213 Endometrial cancer
    102481394 (TCF7L1)
   05224 Breast cancer
    102481394 (TCF7L1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102481394 (TCF7L1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102481394 (TCF7L1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102481394 (TCF7L1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    102481394 (TCF7L1)
   05165 Human papillomavirus infection
    102481394 (TCF7L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tup03000]
    102481394 (TCF7L1)
Transcription factors [BR:tup03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    102481394 (TCF7L1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2 NINJA_B
Other DBs
NCBI-GeneID: 102481394
NCBI-ProteinID: XP_006149210
LinkDB
Position
Un
AA seq 463 aa
MIPDLSSPYLSNGPLSPGGARTYLQMKWPLLDVPSSATVKDTRSPSPAHLSNKVPVVQHP
HHMHPLTPLITYSNDHFSPGSPPTHLSPEIDPKTGIPRPPHPSELSPYYPLSPGAVGQIP
HPLGWLVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSRFSPHMVAPAHPGLPTSGI
PHPAIVSPIVKQEPAPPSLSPAVSAKSPVTVKKEEEKKPHVKKPLNAFMLYMKEMRAKVV
AECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHSQLYPTWSARDNYGKKKKR
KREKQLSQTQSQQQVQDAEGALASKSKKPCVQYLPPEKPCDSPASSHGSMLDSPATPSAA
LASPAAPAATHSEQAQPLSLTTKPETRAQLALHSAAFLSAKAAATSSGPMGGQPPLLSRP
LPLGSVPAALLTSPPSFPATLHAHQALPVLQAQPLSLVTKSAH
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgatcccggacctgagcagcccgtacctctccaacgggcccctgtctcccggaggagcg
cgcacgtacctgcagatgaaatggcccctcctcgatgtcccctccagtgccactgtcaag
gacacgaggtcaccctctccggcacacttgtccaacaaagttcccgtggttcagcacccg
catcacatgcacccgttgactccgctcatcacctacagcaacgaccacttctcccccggc
tcccctcccacacacctctccccagagatcgatccaaagacaggaatcccccggcccccg
cacccatcggagctgtcgccgtattacccactatctcctggagcggtcggacagatcccc
catcccctcggctggctcgtcccacagcaaggacagcccatgtactcgcttcctcctggc
ggcttccggcacccctacccagccctcgccatgaacgcctccatgtccagcctggtctcc
agtcggttctccccgcacatggtggcccctgctcatcctggtctgcccacctcagggatc
ccccaccccgccatcgtctctcccatcgtcaagcaggagccggccccgcccagcttgagc
cccgcggtgagcgcgaaatcaccagtcaccgtgaaaaaggaggaagaaaagaagccccat
gtgaagaagcccctcaatgccttcatgttgtatatgaaggagatgcgggccaaggtggtg
gccgagtgcaccctgaaggaaagcgcagccattaaccaaatcctgggaagaaagtggcac
aacctgtctcgagaagaacaggccaagtactacgagctggcccggaaggagcggcagctt
cactcccagctctacccaacctggtctgcccgggacaactacggtaagaaaaagaagagg
aagagagagaagcagctatcgcagacacagtcccagcagcaagtccaagacgcagagggt
gctctggcctccaagagcaagaagccatgtgttcagtacctgccccccgagaagccctgt
gacagcccggcctcctcccacggcagcatgctggactcccctgccaccccctccgcggcc
ttggcctccccggctgcccccgccgccacgcactcggagcaagctcagcctctctccctc
accaccaagccagagacccgggcccagctggctctgcactccgccgccttcctgtcagcc
aaggctgcagccacctcctctggcccgatgggcggccagcccccgctcctgtcccggccc
ctccctctcgggtccgtgcccgccgccctgctgacctctcctccttccttcccggccacg
ctgcatgcccaccaggccctcccggtgctccaggcccagcctctgtccttggtcaccaag
tctgcccactaa

KEGG   Tupaia chinensis (Chinese tree shrew): 102484318
Entry
102484318         CDS       T02978                                 

Gene name
TCF7
Definition
(RefSeq) transcription factor 7 (T-cell specific, HMG-box)
  KO
K02620  transcription factor 7
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04310  Wnt signaling pathway
tup04390  Hippo signaling pathway
tup04520  Adherens junction
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04916  Melanogenesis
tup04934  Cushing syndrome
tup05132  Salmonella infection
tup05165  Human papillomavirus infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05200  Pathways in cancer
tup05210  Colorectal cancer
tup05213  Endometrial cancer
tup05215  Prostate cancer
tup05216  Thyroid cancer
tup05217  Basal cell carcinoma
tup05221  Acute myeloid leukemia
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
tup05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102484318 (TCF7)
   04390 Hippo signaling pathway
    102484318 (TCF7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102484318 (TCF7)
   04550 Signaling pathways regulating pluripotency of stem cells
    102484318 (TCF7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102484318 (TCF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102484318 (TCF7)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102484318 (TCF7)
   05225 Hepatocellular carcinoma
    102484318 (TCF7)
   05226 Gastric cancer
    102484318 (TCF7)
   05216 Thyroid cancer
    102484318 (TCF7)
   05221 Acute myeloid leukemia
    102484318 (TCF7)
   05217 Basal cell carcinoma
    102484318 (TCF7)
   05215 Prostate cancer
    102484318 (TCF7)
   05213 Endometrial cancer
    102484318 (TCF7)
   05224 Breast cancer
    102484318 (TCF7)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102484318 (TCF7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102484318 (TCF7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102484318 (TCF7)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    102484318 (TCF7)
   05165 Human papillomavirus infection
    102484318 (TCF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tup03000]
    102484318 (TCF7)
Transcription factors [BR:tup03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    102484318 (TCF7)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 102484318
NCBI-ProteinID: XP_014439083
LinkDB
Position
Un
AA seq 437 aa
MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKCRDSAAGPERDLAELKSSLVNESE
GVAGGSGVPGPGAGARSETEVGAEALGREHTSQRLFPDKLPESLEDGLKAPECASGMYKE
TVYSAFNLLMHYPPPSGAGQHPQPQPPLVSGPSSQGPPRACCLLDQHNKASQPPHSVPQL
SPLYEHFSSPHPTPAPADVSQKQGVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWPSPPLY
PLSPSCGYRQHFPAPTAAPGAPYPRFTHPSLMLGSGVPGHPAAIPHPAIVPSSGKQEMQP
YDRSLKTQAESKVEKEAKKPTIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRW
HALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESSTGGKRNAFGT
YPEKAAAPAPFLPMTVL
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgccgcagctggactcgggcgggggcggcgcgggcggcggcgacgacctgggcgcaccg
gatgagctgctggccttccaggacgagggcgaggaacaggacgacaagtgccgcgacagc
gcagcgggccccgagcgcgacctggccgaactcaagtcgtcgctcgtgaacgagtcggag
ggcgtggccggtggctcgggggtcccagggccgggcgccggcgcccgcagtgagaccgag
gtcggggccgaggccctcgggagggagcacacttcgcagagacttttcccggacaaactt
ccagagtctctggaggatggcctgaaggccccggagtgcgccagcggcatgtacaaagag
accgtctactccgctttcaatctgctcatgcactacccgcccccctctggagcagggcag
cacccccagccgcagcccccgctggtaagtggccccagcagccagggcccaccccgtgcc
tgctgccttcttgaccagcacaacaaggccagtcagccccctcacagcgtcccccagctc
tctcctctctatgagcatttcagcagccctcaccctacacctgcacctgcggatgtcagc
cagaaacaaggagtccacaggcctctgcagacccctgacctctctggcttctactctctg
acctcgggcagcatggggcagctcccccacactgtgagctggcccagccctcctctctac
cccctgtccccttcctgcggatatagacagcacttccctgcccccactgcagcccctggc
gccccctaccccaggttcacccacccgtccctgatgctaggctccggtgtacctggtcac
cctgcagccatcccccacccggccatcgtgccctcctcagggaagcaggagatgcagccc
tatgaccgcagcctgaagacgcaggcggagtccaaggtggagaaagaggctaagaagcca
accatcaagaagcccctcaatgccttcatgctgtacatgaaggagatgcgagccaaggtc
attgcagagtgcacgctcaaggagagcgccgccatcaaccagatcctgggccgcaggtgg
catgcgctgtcgcgggaagaacaggccaagtactatgagctggcccgcaaggagaggcag
ctgcacatgcagctgtacccgggatggtcggcgcgggacaactacgggaagaagaagagg
cggtccagggaaaagcaccaagagtccagcacaggaggaaaaagaaatgcattcggtact
tacccggagaaggccgctgccccagccccgttccttccgatgacagtgctctag

DBGET integrated database retrieval system