KEGG   Tupaia chinensis (Chinese tree shrew): 102472926
Entry
102472926         CDS       T02978                                 

Gene name
CASP3
Definition
(RefSeq) caspase 3
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01524  Platinum drug resistance
tup04010  MAPK signaling pathway
tup04115  p53 signaling pathway
tup04210  Apoptosis
tup04215  Apoptosis - multiple species
tup04650  Natural killer cell mediated cytotoxicity
tup04657  IL-17 signaling pathway
tup04668  TNF signaling pathway
tup04726  Serotonergic synapse
tup04932  Non-alcoholic fatty liver disease
tup04933  AGE-RAGE signaling pathway in diabetic complications
tup05010  Alzheimer disease
tup05012  Parkinson disease
tup05014  Amyotrophic lateral sclerosis
tup05016  Huntington disease
tup05020  Prion disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05132  Salmonella infection
tup05133  Pertussis
tup05134  Legionellosis
tup05145  Toxoplasmosis
tup05146  Amoebiasis
tup05152  Tuberculosis
tup05160  Hepatitis C
tup05161  Hepatitis B
tup05162  Measles
tup05163  Human cytomegalovirus infection
tup05164  Influenza A
tup05165  Human papillomavirus infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05168  Herpes simplex virus 1 infection
tup05169  Epstein-Barr virus infection
tup05170  Human immunodeficiency virus 1 infection
tup05200  Pathways in cancer
tup05203  Viral carcinogenesis
tup05205  Proteoglycans in cancer
tup05206  MicroRNAs in cancer
tup05210  Colorectal cancer
tup05222  Small cell lung cancer
tup05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102472926 (CASP3)
   04668 TNF signaling pathway
    102472926 (CASP3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102472926 (CASP3)
   04215 Apoptosis - multiple species
    102472926 (CASP3)
   04115 p53 signaling pathway
    102472926 (CASP3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102472926 (CASP3)
   04657 IL-17 signaling pathway
    102472926 (CASP3)
  09156 Nervous system
   04726 Serotonergic synapse
    102472926 (CASP3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102472926 (CASP3)
   05206 MicroRNAs in cancer
    102472926 (CASP3)
   05205 Proteoglycans in cancer
    102472926 (CASP3)
   05203 Viral carcinogenesis
    102472926 (CASP3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102472926 (CASP3)
   05222 Small cell lung cancer
    102472926 (CASP3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102472926 (CASP3)
   05012 Parkinson disease
    102472926 (CASP3)
   05014 Amyotrophic lateral sclerosis
    102472926 (CASP3)
   05016 Huntington disease
    102472926 (CASP3)
   05020 Prion disease
    102472926 (CASP3)
   05022 Pathways of neurodegeneration - multiple diseases
    102472926 (CASP3)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102472926 (CASP3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102472926 (CASP3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102472926 (CASP3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102472926 (CASP3)
   05133 Pertussis
    102472926 (CASP3)
   05134 Legionellosis
    102472926 (CASP3)
   05152 Tuberculosis
    102472926 (CASP3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102472926 (CASP3)
   05161 Hepatitis B
    102472926 (CASP3)
   05160 Hepatitis C
    102472926 (CASP3)
   05164 Influenza A
    102472926 (CASP3)
   05162 Measles
    102472926 (CASP3)
   05168 Herpes simplex virus 1 infection
    102472926 (CASP3)
   05163 Human cytomegalovirus infection
    102472926 (CASP3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102472926 (CASP3)
   05169 Epstein-Barr virus infection
    102472926 (CASP3)
   05165 Human papillomavirus infection
    102472926 (CASP3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102472926 (CASP3)
   05145 Toxoplasmosis
    102472926 (CASP3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102472926 (CASP3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tup01002]
    102472926 (CASP3)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     102472926 (CASP3)
Peptidases and inhibitors [BR:tup01002]
 Cysteine peptidases
  Family C14: caspase family
   102472926 (CASP3)
SSDB
Motif
Pfam: Peptidase_C14 UPF0240
Other DBs
NCBI-GeneID: 102472926
NCBI-ProteinID: XP_006160499
LinkDB
Position
Un
AA seq 327 aa
MGALVTRAIRNLNLENRAEWEISKMKPSSAPMHPSTKRLLQEQMIRHPEIKGETDRKDDK
LLSLLKNVKIIHGSKSMDSGISSDESYKMDYPQMGLCIIINNKNFHKSTGMSCRSGTDVD
AANLRETFMNLKYEVRHKNDLTREEMIEFLQKVSKEDHSKRSSFVCVLLSHGEEGIIFGT
NGPVDLKKITGFFRGDYCRSLMGKPKIFIIQACRGTELDCGIETDSGIDEDMACQKIPVE
ADFLYAYSTAPGYYSWRNSRDGSWFIQSLCAMLKQYAHKLEFMHILTRVNRKVALDFESF
SLDPTFHAKKQIPCIVSMLTKDLYFHP
NT seq 984 nt   +upstreamnt  +downstreamnt
atgggggctttggtgactcgcgcaatcagaaatttgaacctagagaaccgagcggaatgg
gaaatcagcaagatgaaaccctcttctgctcccatgcacccttccaccaagaggctcctg
caggaacagatgatccgccatccagaaattaagggagagactgacagaaaagatgacaag
ttgctatcattactgaaaaacgtaaagattatacatggaagcaaatcaatggactctgga
atatcctcggacgaaagttacaaaatggattatcctcaaatgggtttatgtataataatt
aataacaagaactttcataaaagtactggaatgtcatgtcggtctggtacagatgtagat
gccgcaaacctcagggaaacattcatgaacttaaaatatgaagtcaggcataaaaatgac
cttacacgtgaagaaatgatagaattcttgcaaaaagtttctaaagaagatcacagcaaa
aggagcagttttgtctgtgtgcttcttagccatggtgaagaaggaatcatttttggaaca
aatggacctgttgacctgaaaaaaataactggtttctttagaggagattattgtagaagc
ctaatgggaaaacccaagattttcatcattcaggcgtgccgaggtacagaactggactgc
ggcattgagacagacagtggcattgatgaggacatggcatgtcagaaaattccagttgag
gccgacttcctgtatgcctattcgacagcacctggttactattcctggcgaaattcgagg
gacggatcctggttcatccagtcactttgtgctatgctgaaacagtatgcccacaagctt
gagtttatgcatattctcacccgtgttaaccgaaaagtagccctagattttgagtctttt
tccctcgaccctacttttcatgcaaagaaacagattccatgtattgtgtccatgctcaca
aaagacttgtattttcatccctaa

KEGG   Tupaia chinensis (Chinese tree shrew): 102487119
Entry
102487119         CDS       T02978                                 

Definition
(RefSeq) caspase-3-like
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01524  Platinum drug resistance
tup04010  MAPK signaling pathway
tup04115  p53 signaling pathway
tup04210  Apoptosis
tup04215  Apoptosis - multiple species
tup04650  Natural killer cell mediated cytotoxicity
tup04657  IL-17 signaling pathway
tup04668  TNF signaling pathway
tup04726  Serotonergic synapse
tup04932  Non-alcoholic fatty liver disease
tup04933  AGE-RAGE signaling pathway in diabetic complications
tup05010  Alzheimer disease
tup05012  Parkinson disease
tup05014  Amyotrophic lateral sclerosis
tup05016  Huntington disease
tup05020  Prion disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05132  Salmonella infection
tup05133  Pertussis
tup05134  Legionellosis
tup05145  Toxoplasmosis
tup05146  Amoebiasis
tup05152  Tuberculosis
tup05160  Hepatitis C
tup05161  Hepatitis B
tup05162  Measles
tup05163  Human cytomegalovirus infection
tup05164  Influenza A
tup05165  Human papillomavirus infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05168  Herpes simplex virus 1 infection
tup05169  Epstein-Barr virus infection
tup05170  Human immunodeficiency virus 1 infection
tup05200  Pathways in cancer
tup05203  Viral carcinogenesis
tup05205  Proteoglycans in cancer
tup05206  MicroRNAs in cancer
tup05210  Colorectal cancer
tup05222  Small cell lung cancer
tup05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102487119
   04668 TNF signaling pathway
    102487119
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102487119
   04215 Apoptosis - multiple species
    102487119
   04115 p53 signaling pathway
    102487119
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102487119
   04657 IL-17 signaling pathway
    102487119
  09156 Nervous system
   04726 Serotonergic synapse
    102487119
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102487119
   05206 MicroRNAs in cancer
    102487119
   05205 Proteoglycans in cancer
    102487119
   05203 Viral carcinogenesis
    102487119
  09162 Cancer: specific types
   05210 Colorectal cancer
    102487119
   05222 Small cell lung cancer
    102487119
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102487119
   05012 Parkinson disease
    102487119
   05014 Amyotrophic lateral sclerosis
    102487119
   05016 Huntington disease
    102487119
   05020 Prion disease
    102487119
   05022 Pathways of neurodegeneration - multiple diseases
    102487119
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102487119
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102487119
   04933 AGE-RAGE signaling pathway in diabetic complications
    102487119
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102487119
   05133 Pertussis
    102487119
   05134 Legionellosis
    102487119
   05152 Tuberculosis
    102487119
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102487119
   05161 Hepatitis B
    102487119
   05160 Hepatitis C
    102487119
   05164 Influenza A
    102487119
   05162 Measles
    102487119
   05168 Herpes simplex virus 1 infection
    102487119
   05163 Human cytomegalovirus infection
    102487119
   05167 Kaposi sarcoma-associated herpesvirus infection
    102487119
   05169 Epstein-Barr virus infection
    102487119
   05165 Human papillomavirus infection
    102487119
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102487119
   05145 Toxoplasmosis
    102487119
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102487119
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tup01002]
    102487119
Enzymes [BR:tup01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     102487119
Peptidases and inhibitors [BR:tup01002]
 Cysteine peptidases
  Family C14: caspase family
   102487119
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 102487119
NCBI-ProteinID: XP_014438862
LinkDB
Position
Un
AA seq 475 aa
MIAVSCSTLLLGATGPEIVRGMFVDLYKISAIPEKQSTSCAPGWCRGLKSDVCPEEKDEL
CKIKAGSTPPQVLNAFTRPSLPPTGKKQAQASRSKDTEWMDCCPSLRQGQAEAPQNKELV
ECLELEQLNPGSYPAHAYGANDHLPDPMWNFHDTPTRNRVSFFGEIKRDKSKQEPLTEQK
QIASRVARSRAGVRLEWSCVLIKVSIENNESSVDSKLVENSEAKIMHGSKSMDSGISSDE
SYKMDYPQMGLCIIINNKNFHKSTGMSCRSGTDVDAANIRETFMNLKYAVRHRNDLTREE
MIEFLQKVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITGFFRGDYCRSLMGKP
KIFIIQACRGTELDCGIETDSGIDEDMACQKIPVEADFLYTYSTAPGYYSWRNSRDGSWF
VQSRCAMLKQHAHKLEFMHILTRVKRKVALDFESFSLNPTFHAKKQIPYIVYFHP
NT seq 1428 nt   +upstreamnt  +downstreamnt
atgatagctgtttcatgctcaactctgctcttgggagccactggccctgaaatagtgaga
gggatgtttgtggacctctacaaaatcagcgccattccagaaaagcaaagtacaagttgt
gctccaggttggtgcaggggtctgaagagtgatgtttgcccagaagagaaggacgagctc
tgcaaaatcaaagctggctccacaccacctcaggttctcaatgctttcaccaggcctagt
ttgccacctactggcaagaagcaggcacaagcatccaggagcaaggacactgaatggatg
gactgctgcccttcgctcaggcagggacaggcagaagcgccccagaacaaggagttggtt
gaatgtttagagctggagcagctgaacccaggttcttatccagcccacgcctacggagcc
aatgaccacctccctgatccaatgtggaatttccacgacacccctactagaaaccgagtt
tcattctttggagaaatcaaacgagataaatctaagcaggaaccattgacagaacagaaa
caaattgcttctagggtggcgcggagcagagcaggagtgcggctggagtggagctgcgtg
ttaataaaagtatccattgagaacaatgaaagctcagtggattcaaagctcgttgagaat
tcagaagcaaagattatgcatggaagcaaatcgatggactctggaatatcctcggatgaa
agttacaaaatggattatcctcaaatgggtttatgtataataattaataacaagaacttt
cataaaagtactggaatgtcatgtaggtctggtacagatgtagatgcagcaaacatcagg
gaaaccttcatgaacttaaaatatgcagtcaggcatagaaatgaccttacacgtgaagaa
atgatagaattcttgcaaaaagtttctaaagaagatcacagcaaaaggagcagttttgtc
tgtgtgcttcttagccatggtgaagaaggaatcatttttggaacaaatggacctgttgac
ctgaaaaaaataactggtttctttagaggagattattgtagaagcctaatgggaaaaccc
aagattttcatcattcaggcgtgccgaggtacagaactggactgcggcattgagacagac
agtggcattgatgaggacatggcatgtcagaaaattccagttgaggccgacttcctgtac
acctattctacagcacctggttactattcctggcgaaattcaagggacggatcctggttc
gtccagtcacgttgtgctatgctgaaacagcatgcccacaagcttgagtttatgcatatt
ctcacccgtgttaagcgaaaggtagccctagattttgagtctttttccctcaaccctact
tttcatgcaaaaaaacagattccatatattgtgtattttcatccctaa

DBGET integrated database retrieval system