KEGG   Tupaia chinensis (Chinese tree shrew): 102472932
Entry
102472932         CDS       T02978                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04010  MAPK signaling pathway
tup04014  Ras signaling pathway
tup04015  Rap1 signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04390  Hippo signaling pathway
tup04810  Regulation of actin cytoskeleton
tup05200  Pathways in cancer
tup05218  Melanoma
tup05224  Breast cancer
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102472932 (FGF1)
   04014 Ras signaling pathway
    102472932 (FGF1)
   04015 Rap1 signaling pathway
    102472932 (FGF1)
   04390 Hippo signaling pathway
    102472932 (FGF1)
   04151 PI3K-Akt signaling pathway
    102472932 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102472932 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102472932 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    102472932 (FGF1)
   05218 Melanoma
    102472932 (FGF1)
   05224 Breast cancer
    102472932 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:tup04052]
    102472932 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:tup00536]
    102472932 (FGF1)
Cytokines and growth factors [BR:tup04052]
 Growth factors
  Growth factors (RTK binding)
   102472932 (FGF1)
Glycosaminoglycan binding proteins [BR:tup00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   102472932 (FGF1)
SSDB
Motif
Pfam: FGF Fascin Nab2p_Zf1
Other DBs
NCBI-GeneID: 102472932
NCBI-ProteinID: XP_006144848
UniProt: L9L220
LinkDB
Position
Un
AA seq 155 aa
MAEGEITTFAALTEKFDLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LTAENVGEVYIKSTETGQYLAMDADGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEK
NWFVALKKNGSCKLGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggggaaatcacgaccttcgcagccctgaccgagaagtttgatctgcctcca
gggaattacaagaagcccaaacttctctactgtagcaacgggggccatttcttgaggatt
cttccagatggcaccgtggatgggacaagagacaggagcgaccagcacattcagctgcag
ctcactgcggaaaacgtgggggaggtgtacataaagagtacggagactggccagtacttg
gccatggacgccgacgggcttttatatggctcacagacaccaaacgaggaatgtttgttc
ctggaaaggctggaggagaaccattacaacacctacatatccaagaagcacgcagagaag
aattggtttgttgccctcaagaagaacggaagctgcaaactcggtcctcggactcactat
ggccagaaagcaatcttgtttctccccctgccagtctcctctgattaa

DBGET integrated database retrieval system