KEGG   Tupaia chinensis (Chinese tree shrew): 102473622
Entry
102473622         CDS       T02978                                 

Gene name
ITPR1
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 1
  KO
K04958  inositol 1,4,5-triphosphate receptor type 1
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04020  Calcium signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04070  Phosphatidylinositol signaling system
tup04114  Oocyte meiosis
tup04140  Autophagy - animal
tup04210  Apoptosis
tup04218  Cellular senescence
tup04270  Vascular smooth muscle contraction
tup04371  Apelin signaling pathway
tup04540  Gap junction
tup04611  Platelet activation
tup04621  NOD-like receptor signaling pathway
tup04625  C-type lectin receptor signaling pathway
tup04713  Circadian entrainment
tup04720  Long-term potentiation
tup04723  Retrograde endocannabinoid signaling
tup04724  Glutamatergic synapse
tup04725  Cholinergic synapse
tup04726  Serotonergic synapse
tup04728  Dopaminergic synapse
tup04730  Long-term depression
tup04750  Inflammatory mediator regulation of TRP channels
tup04912  GnRH signaling pathway
tup04915  Estrogen signaling pathway
tup04918  Thyroid hormone synthesis
tup04921  Oxytocin signaling pathway
tup04922  Glucagon signaling pathway
tup04924  Renin secretion
tup04925  Aldosterone synthesis and secretion
tup04927  Cortisol synthesis and secretion
tup04928  Parathyroid hormone synthesis, secretion and action
tup04929  GnRH secretion
tup04934  Cushing syndrome
tup04935  Growth hormone synthesis, secretion and action
tup04970  Salivary secretion
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup05010  Alzheimer disease
tup05012  Parkinson disease
tup05016  Huntington disease
tup05017  Spinocerebellar ataxia
tup05020  Prion disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05163  Human cytomegalovirus infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05170  Human immunodeficiency virus 1 infection
tup05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102473622 (ITPR1)
   04020 Calcium signaling pathway
    102473622 (ITPR1)
   04070 Phosphatidylinositol signaling system
    102473622 (ITPR1)
   04022 cGMP-PKG signaling pathway
    102473622 (ITPR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102473622 (ITPR1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102473622 (ITPR1)
   04210 Apoptosis
    102473622 (ITPR1)
   04218 Cellular senescence
    102473622 (ITPR1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102473622 (ITPR1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102473622 (ITPR1)
   04621 NOD-like receptor signaling pathway
    102473622 (ITPR1)
   04625 C-type lectin receptor signaling pathway
    102473622 (ITPR1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102473622 (ITPR1)
   04929 GnRH secretion
    102473622 (ITPR1)
   04912 GnRH signaling pathway
    102473622 (ITPR1)
   04915 Estrogen signaling pathway
    102473622 (ITPR1)
   04921 Oxytocin signaling pathway
    102473622 (ITPR1)
   04935 Growth hormone synthesis, secretion and action
    102473622 (ITPR1)
   04918 Thyroid hormone synthesis
    102473622 (ITPR1)
   04928 Parathyroid hormone synthesis, secretion and action
    102473622 (ITPR1)
   04924 Renin secretion
    102473622 (ITPR1)
   04925 Aldosterone synthesis and secretion
    102473622 (ITPR1)
   04927 Cortisol synthesis and secretion
    102473622 (ITPR1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102473622 (ITPR1)
  09154 Digestive system
   04970 Salivary secretion
    102473622 (ITPR1)
   04971 Gastric acid secretion
    102473622 (ITPR1)
   04972 Pancreatic secretion
    102473622 (ITPR1)
  09156 Nervous system
   04724 Glutamatergic synapse
    102473622 (ITPR1)
   04725 Cholinergic synapse
    102473622 (ITPR1)
   04728 Dopaminergic synapse
    102473622 (ITPR1)
   04726 Serotonergic synapse
    102473622 (ITPR1)
   04720 Long-term potentiation
    102473622 (ITPR1)
   04730 Long-term depression
    102473622 (ITPR1)
   04723 Retrograde endocannabinoid signaling
    102473622 (ITPR1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102473622 (ITPR1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102473622 (ITPR1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102473622 (ITPR1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102473622 (ITPR1)
   05012 Parkinson disease
    102473622 (ITPR1)
   05016 Huntington disease
    102473622 (ITPR1)
   05017 Spinocerebellar ataxia
    102473622 (ITPR1)
   05020 Prion disease
    102473622 (ITPR1)
   05022 Pathways of neurodegeneration - multiple diseases
    102473622 (ITPR1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102473622 (ITPR1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102473622 (ITPR1)
   05163 Human cytomegalovirus infection
    102473622 (ITPR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102473622 (ITPR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tup01009]
    102473622 (ITPR1)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:tup04040]
    102473622 (ITPR1)
Protein phosphatases and associated proteins [BR:tup01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102473622 (ITPR1)
Ion channels [BR:tup04040]
 Ligand-gated channels
  IP3 receptor
   102473622 (ITPR1)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Other DBs
NCBI-GeneID: 102473622
NCBI-ProteinID: XP_014441251
LinkDB
Position
Un
AA seq 2760 aa
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPEAGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGANNTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAEVDPDFEEECLEFQPSVDPDQDASRSRLRNAQEKMVYSLVSVPE
GNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGT
SPVKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDL
VYFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEE
LGDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLH
NNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPT
NADILIETKLVLSRFEFEGVSTGENALEAGEDEEEVWLFWRDSNKEIRSKSVRELAQDAK
EGQKEDRDVLSYYRYQLNLFARMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRAS
FCRLMLHMHVDRDPQEQVTPVKYARLWSEIPSEIAIDDYDSSGTSKDDIKERFAQTMEFV
EEYLRDVVCQRFPFSDKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKILLAILDCVHV
TTIFPITKITKGEENKGNNDVEKMKSSNVMRSIHGVGELMTQVVLRGGGFLPMTPMAAAP
EGNVKQAEPEKEDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKRQFDESNSQTSET
SSGNSSQEGPSSVPGALDFEHIEEQAEGIFGGSEENTPLDLDDHGGRTFLRVLLHLTMHD
YPPLVSGALPLQLLFRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKS
ELWVYKGQGPDETMDGASGENEHKKTEEGNNKSQKHESTSSYNYRVVKEILIRLSKLCVQ
ESASVRKSRKQQQRLLRNMGAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQNFCAGNQ
QNQALLHKHINLFLNPGILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYI
KFLQTIVKAEGKFIKKCQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDENS
PLMYHIHLVELLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHC
YVDTEVEMKEIYTSNHMWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTF
FSSPFSDQSTTLQTRQPVFVQLLQGVFRVYHCNWLMPSQKASVEGCIRVLSDVAKSRAIA
IPVDLDSQVNNLFLKSHNIVQKTAMNWRLSARNAARRDSVLAASRDYRNIIERLQDIVSA
LEDRLRPLVQAELSVLVDVLHRPELLFPENTDARRKCESGGFICKLIKHTKQLLEENEEK
LCIKVLQTLREMMTKDRGYGEKQISIDELDNAELPQAPEAENSTEQELEPSPPLRQLEDH
KRGEALRQILVNRYYGNIRPSGRRESLTSFGNGPLSPGGPSKPGGGGGGSGSSSMSRGEM
SLAEVQCHLDKEGASNLVIDLIMNASSDRVFHESILLAIALLEGGNTTIQHSFFCRLTED
KKSEKFFKVFYDRMKVAQQEIKATVTVNTSDLGNKKKDDEVDRDAPSRKKAKEPSTQITE
EVRDQLLEASAATRKAFTTFRREADPDDHYQSGEGTQATADKTKDDLEMSAVITIMQPIL
RFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEKNV
ALINQTLESLTEYCQGPCHENQNCIATHESNGIDIITALILNDINPLGKKRMDLVLELKN
NASKLLLAIMESRHDSENAERILYNMRPKELVEVIKKAYMQGEVEFEDGENGEDGAASPR
NVGHNIYILAHQLARHNKELQTMLKPGGQVDGDEALEFYAKHTAQIEIVRLDRTMEQIVF
PVPSICEFLTKESKLRIYYTTERDEQGSKINDFFLRSEDLFNEMNWQKKLRAQPVLYWCA
RNMSFWSSISFNLAVLMNLLVAFFYPFKGVRGGTLEPHWSGLLWTAMLISLAIVIALPKP
HGIRALIASTILRLIFSVGLQPTLFLLGAFNVCNKIIFLMSFVGNCGTFTRGYRAMVLDV
EFLYHLLYLLICAMGLFVHEFFYSLLLFDLVYREETLLNVIKSVTRNGRSIILTAVLALI
LVYLFSIVGYLFFKDDFILEVDRLPNETALPETSESMAADFLYPDVCRVETGENCSSPAP
KEELVPAEETEQDKEHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIYD
LLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEE
HIKEEHNMWHYLCFIVLVKVKDSTEYTGPESYVAEMIKERNLDWFPRMRAMSLVSSDSEG
EQNELRNLQEKLESTMKLVTNLSGQLSELKDQMTEQRKQKQRIGLLGHPPHMNVNPQQPA
NT seq 8283 nt   +upstreamnt  +downstreamnt
atgtctgacaaaatgtctagtttcctgcacattggagacatttgttctctgtacgcggag
ggatcgacgaatggatttattagcaccttgggcctggtcgatgatcgttgtgttgtacaa
ccagaagccggagaccttaacaatccacctaagaaattcagagactgcctcttcaagcta
tgtcccatgaatcgctactctgcccagaagcagttctggaaagccgctaagcccggagcc
aacaacaccacagacgccgtgctgctcaacaaactgcatcatgctgcagacttggaaaag
aagcagaacgagacagaaaacaggaagttgctggggaccgtcattcagtatggcaatgtg
atccagctcctgcatttgaaaagtaataaatacctaactgtgaataagaggcttcctgct
ctcctggagaagaatgccatgagggtgacactagacgaggcgggaaatgaagggtcctgg
ttttatattcagccattctacaagctgcgatccatcggtgacagcgtggtcataggtgac
aaggttgtcctgaacccggtcaatgctggtcagcccctgcacgccagcagccatcagctg
gtagataaccctggctgcaacgaggtcaattccgtcaactgcaacacaagctggaaaata
gtccttttcatgaaatggagtgataacaaagatgacatattaaaggggggtgacgtggtg
aggctcttccatgccgagcaggagaagtttctcacctgtgacgagcacaggaagaagcag
catgtcttcctgagaacgacaggcaggcagtcagccacatctgccactagttcaaaagcc
ctgtgggaagttgaggtagtccagcatgacccatgtcggggtggagcaggatattggaac
agcctcttccgtttcaagcatctggctacaggccattacttagcagcagaggtagaccct
gactttgaggaagaatgcctggagtttcagccctcagtggatcctgatcaggatgcatct
cgaagtcggttgcgaaatgcccaagaaaagatggtgtactccctggtgtccgtgccagaa
ggcaatgacatctcctccatttttgagctagaccccaccactctccgtggaggtgacagc
cttgtcccaaggaactcctacgttcggctcagacatctgtgtactaatacctgggtgcac
agcacaaatattcccattgacaaagaagaagaaaaacccgtgatgctgaaaattggcacc
tctcctgtgaaggaggacaaggaagcatttgccattgttccagtttctcctgctgaagtc
cgggatctggactttgccaatgatgccagcaaagtgctgggctccattgctgggaagctg
gagaagggcaccatcacccaaaacgagagaaggtctgtaaccaagctgctggaagactta
gtttactttgtcactggtggaactaactctggtcaagacgtgcttgaggtggtcttctcc
aagcccaaccgagaacggcagaagctgatgagagaacagaacattctcaagcagatcttc
aagttattacaggccccgttcacagactgtggcgatggcccgatgcttcggctggaggaa
cttggggaccagcggcacgctcccttcagacatatctgccggctctgctacagggtcctg
agacactcgcagcaggactacaggaagaaccaggagtatatagccaagcagtttggcttc
atgcagaagcagattggctatgatgtgttggccgaagacactatcactgccctgctccac
aacaatcgaaaactcctggaaaaacacatcactgctgcagagattgacacgtttgtcagt
ctggtgcgaaagaacagggagcccagattcttagattacctctctgacctctgtgtctct
atgaacaaatccatcccagtgacccaggagctgatctgcaaagctgtgctgaatcccacc
aacgccgacatcctcattgagaccaagttggttctttctcgttttgaatttgaaggtgtt
tctactggagagaatgctctggaggcaggagaagatgaagaagaggtgtggttattttgg
agggacagcaacaaagagattcgcagtaagagtgtcagagaattggcacaggatgcaaag
gaggggcaaaaggaagaccgcgatgttctcagctactacaggtatcagctgaacctcttt
gctcggatgtgtctggaccgccagtatctggccatcaatgaaatatcaggccagctggac
gtagatctcattcttcgctgcatgtcagatgagaacctgccttatgacctgagggcatcc
ttctgccgactcatgcttcacatgcacgtggaccgagacccccaggaacaagtcacacct
gtaaaatacgcccgcctctggtcggagatcccctctgagatcgccattgacgactatgat
agtagtggaacttccaaagatgacattaaggagagatttgctcagaccatggaatttgtg
gaggagtatttaagagatgtggtttgtcaaaggtttcctttctctgataaggagaaaaat
aagctgacatttgaggttgtaaatttagctaggaatctcatatactttggtttctacaac
ttctctgaccttctgcgattaaccaagatcctcctggccatcttggactgtgtgcatgtg
acaacaatcttccccattaccaagataacaaaaggagaagagaataaaggtaacaatgat
gtggagaaaatgaagagcagtaacgtgatgagatctatccatggagttggggagctgatg
acacaggtggtcctccgtggaggaggctttttgcccatgactcctatggctgccgcccct
gaaggcaacgtgaagcaggcggagccagagaaggaggatatcatggtcatggacaccaag
ttgaagatcattgagattctccagtttattttgaatgtgaggttggattataggatctcc
tgcctcctgtgtatatttaagcggcagtttgatgaaagcaattcccagacttcggaaaca
tcctccggaaacagcagccaggaagggccaagtagcgtaccaggtgctcttgactttgaa
catattgaagagcaagcagaaggcatctttggaggaagtgaggagaacacccccctggac
ctggacgatcacggcggcagaacctttctccgagtcttgctccatttgacgatgcatgac
tacccgcctctagtgtcgggggccctgcccctgcagctcctcttccggcatttcagtcag
aggcaggaggtcctccaggcttttaaacaggttcaactgctggttaccagccaagatgtg
gacaactacaaacaaatcaaacaagacttggatcagctgaggtccatcgtggagaagtct
gagctttgggtgtacaaagggcagggccccgatgagaccatggatggtgcatctggtgaa
aatgagcataagaagacagaggaggggaataacaagtcacagaagcacgaaagcaccagt
agctacaactacagagtggtcaaagagattctgattcgacttagcaaactctgtgttcaa
gagagcgcctcggtgaggaagagcaggaagcagcagcagcggctgctccggaacatgggc
gcgcacgccgtggtgctggagctactgcagattccctacgagaaggctgaagataccaag
atgcaggagataatgaggctggcccatgaatttctgcagaatttctgtgcaggcaaccag
cagaatcaagctttgctacacaaacacataaacctgtttctcaatccagggatcctggag
gcagtgacaatgcagcacatcttcatgaacaacttccagctttgcagtgagatcaatgaa
agagtcgttcaacacttcgttcactgcatagagacccacggtcgaaatgtccaatacata
aagttcttgcagacaatcgtcaaggcagaagggaaatttattaagaaatgccaagacatg
gtcatggcagagctggtcaattccggagaggacgtccttgtgttctacaacgacagagcc
tctttccagaccctgattcagatgatgcggtcagagcgggaccgtatggacgagaacagc
cctctcatgtaccacatccacttggtggagctcctggccgtgtgcacagagggcaagaac
gtctacacagagatcaaatgcaactccctgctccctctggatgacattgtccgcgtggtc
acccacgaggactgcatccctgaggttaaaatcgcatatattaacttcctgaatcactgc
tatgtggatactgaggtggaaatgaaggagatctacaccagcaatcacatgtggaaattg
ttcgagaatttccttgtagacatctgcagggcctgtaacaacacaagtgacaggaaacac
gcagactcgattttggagaagtacgttactgaaattgtcatgagcatcgtcactaccttc
ttcagctctcccttctcagaccagagtacgactttgcagacccgccagcccgtctttgtg
cagctgctgcaaggtgtgttcagggtttaccactgcaactggctgatgccgagccaaaaa
gcctccgtggagggctgtattcgggtgctctctgatgtagccaagagccgggccattgcc
attcctgtggacctggacagccaagtcaacaacctctttctgaagtcccacaacattgtg
cagaagacagccatgaactggcggttgtcagctcgcaatgcagcacgaagagactctgtt
ctggcagcttccagagactaccggaatatcattgagagactgcaggacatcgtctcggcc
ctggaagaccggctgcggcccctggtgcaggcagagttatccgtgctggtggatgttctc
cacagacctgagctgcttttcccagagaacacagatgccagaaggaaatgtgaaagtggt
ggtttcatttgcaagttaataaagcatacgaaacagctactagaggaaaacgaggagaaa
ctctgcattaaagtcctccagaccctcagagaaatgatgaccaaagatagagggtatgga
gaaaagcaaatttccattgatgagttggataatgctgagctgccacaggctccggaggcc
gagaactccacagagcaggagcttgaaccaagcccacccctgaggcaactggaagaccat
aaaaggggtgaggcgctcaggcaaattttggtcaaccgttactatggaaacatcagacct
tcaggaagaagagagagtcttaccagctttggcaacggcccgctgtcaccaggaggaccc
agcaagcctgggggaggagggggaggttctggatccagctctatgagccggggtgagatg
agcctggctgaggttcagtgtcaccttgacaaggaaggggcctccaatctggtgatcgac
ctcataatgaacgcgtccagtgaccgagtgttccatgaaagcattctcctggccatcgcc
ctgctggaaggagggaacaccactatacagcactctttcttctgccgattgacagaagac
aagaagtcggagaaattctttaaggtcttctatgatcgaatgaaagtggcccagcaggaa
attaaggcaacagtgacagtgaacaccagtgacctgggaaataagaagaaagacgatgag
gtagacagggatgccccgtctcggaaaaaagccaaggagccctccacacagataacagag
gaggtccgggatcagctcctggaggcctccgccgccaccaggaaagccttcaccaccttc
aggagggaggccgaccctgatgaccactaccagtctggggagggcacccaggccacggcg
gacaagaccaaggacgacctggagatgagtgcggtcatcaccatcatgcagcccatcctc
cgcttcctgcagctcctgtgtgagaaccacaaccgagacctgcagaacttcctccgttgc
caaaataacaagaccaactacaatttggtatgtgagacgctgcagtttctggactgtatt
tgtggaagcacaaccggaggccttggtcttctcggactgtacataaacgaaaagaacgta
gcacttatcaaccaaaccctggaaagtctcaccgaatactgtcaagggccttgccatgag
aaccagaactgcatcgccacccatgagtccaatggcatcgacatcatcacagccctgatc
ctcaatgacatcaaccccttgggaaagaagaggatggacctcgtgttggaactgaagaac
aatgcttccaagttgctcctggccatcatggaaagcagacacgacagtgagaacgccgag
aggatactttataacatgaggcccaaggaactggtggaagtgatcaagaaagcctacatg
caaggcgaagtggaatttgaggatggagaaaacggcgaggatggagctgcctcccccagg
aacgtgggacacaacatttatatattagctcaccagctggctcggcataacaaagaactt
cagaccatgctgaaacctggcggccaagtggacggggatgaagcgctggagttttatgcc
aagcacacggcacagatagagatcgtcagactagaccgaacgatggaacagatcgtcttc
ccggtgcccagcatatgtgaattcctaaccaaggagtctaaactgcgcatctactacact
acagagagggatgagcaaggtagcaaaatcaacgacttcttcctgcggtccgaagacctc
ttcaatgagatgaattggcagaagaaactgcgagcccagcccgtcctgtactggtgcgcc
cgcaacatgtccttctggagcagcatctcctttaacctggccgtcctgatgaacctgctg
gtggcatttttctacccatttaaaggagtccgaggaggaacactggagccacactggtca
ggactcctgtggacagccatgctgatctctctggccatcgtcatcgctctccccaagccc
catggcatccgggccttaattgcttccacaattctgcgattgatattttcagtcgggtta
caacccacgttgtttcttctgggagctttcaatgtctgcaacaaaatcatctttctgatg
agctttgtgggcaactgtggaacattcacaagaggctaccgagccatggttctggacgtt
gagttcctctatcatttgctgtatctgctgatctgcgccatggggctctttgtccatgag
ttcttctacagtttgctgctttttgatttagtgtacagagaagagactttgcttaatgtc
attaaaagtgtcactcgcaacggacggtccatcatcctgacagcagttctggctctgatc
ctggtttacttgttctcaatagtgggctatcttttcttcaaggatgattttatcttggaa
gtggatagattgcccaatgaaactgctctcccagaaaccagcgaaagtatggcggccgat
ttcctgtaccctgatgtgtgtagggtggaaactggggagaactgttcttctcctgctccc
aaggaagagctggtccctgcagaggaaacggaacaggataaagagcacacatgtgagacg
ctgctgatgtgcatcgttactgtactgagtcacgggctgcgaagcgggggcggagtagga
gatgtgctcaggaagccgtccaaagaggaacccctctttgctgcaagagtgatttacgac
ctcttgttcttcttcatggtcatcatcattgtccttaacctgatttttggtgtcattatt
gacacctttgccgacctgaggagtgagaagcagaagaaggaggagatcttaaagaccacc
tgctttatctgcggcttggaaagagacaagtttgacaacaagactgtcacctttgaagag
cacatcaaggaagagcacaatatgtggcactacctgtgcttcatcgtcctggtgaaagtc
aaggactccacagagtacactgggcccgagagctacgtggcggaaatgatcaaggaaaga
aaccttgattggttccccaggatgcgagccatgtccttggtcagcagcgattctgaagga
gaacagaatgagctgaggaacctgcaggagaagttggagtccaccatgaagctcgtcact
aatctttctggccagctgtcggaactgaaggaccagatgacagaacaaaggaagcagaaa
caaagaattggtcttctaggacatcctccccacatgaatgtcaacccacagcaaccagcg
taa

KEGG   Tupaia chinensis (Chinese tree shrew): 102475587
Entry
102475587         CDS       T02978                                 

Gene name
ITPR3
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 3
  KO
K04960  inositol 1,4,5-triphosphate receptor type 3
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04020  Calcium signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04070  Phosphatidylinositol signaling system
tup04114  Oocyte meiosis
tup04210  Apoptosis
tup04218  Cellular senescence
tup04270  Vascular smooth muscle contraction
tup04371  Apelin signaling pathway
tup04540  Gap junction
tup04611  Platelet activation
tup04621  NOD-like receptor signaling pathway
tup04625  C-type lectin receptor signaling pathway
tup04713  Circadian entrainment
tup04720  Long-term potentiation
tup04723  Retrograde endocannabinoid signaling
tup04724  Glutamatergic synapse
tup04725  Cholinergic synapse
tup04726  Serotonergic synapse
tup04728  Dopaminergic synapse
tup04730  Long-term depression
tup04742  Taste transduction
tup04750  Inflammatory mediator regulation of TRP channels
tup04911  Insulin secretion
tup04912  GnRH signaling pathway
tup04915  Estrogen signaling pathway
tup04918  Thyroid hormone synthesis
tup04921  Oxytocin signaling pathway
tup04922  Glucagon signaling pathway
tup04924  Renin secretion
tup04925  Aldosterone synthesis and secretion
tup04927  Cortisol synthesis and secretion
tup04928  Parathyroid hormone synthesis, secretion and action
tup04929  GnRH secretion
tup04934  Cushing syndrome
tup04935  Growth hormone synthesis, secretion and action
tup04970  Salivary secretion
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup05010  Alzheimer disease
tup05012  Parkinson disease
tup05014  Amyotrophic lateral sclerosis
tup05017  Spinocerebellar ataxia
tup05020  Prion disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05163  Human cytomegalovirus infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05170  Human immunodeficiency virus 1 infection
tup05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102475587 (ITPR3)
   04020 Calcium signaling pathway
    102475587 (ITPR3)
   04070 Phosphatidylinositol signaling system
    102475587 (ITPR3)
   04022 cGMP-PKG signaling pathway
    102475587 (ITPR3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102475587 (ITPR3)
   04210 Apoptosis
    102475587 (ITPR3)
   04218 Cellular senescence
    102475587 (ITPR3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102475587 (ITPR3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102475587 (ITPR3)
   04621 NOD-like receptor signaling pathway
    102475587 (ITPR3)
   04625 C-type lectin receptor signaling pathway
    102475587 (ITPR3)
  09152 Endocrine system
   04911 Insulin secretion
    102475587 (ITPR3)
   04922 Glucagon signaling pathway
    102475587 (ITPR3)
   04929 GnRH secretion
    102475587 (ITPR3)
   04912 GnRH signaling pathway
    102475587 (ITPR3)
   04915 Estrogen signaling pathway
    102475587 (ITPR3)
   04921 Oxytocin signaling pathway
    102475587 (ITPR3)
   04935 Growth hormone synthesis, secretion and action
    102475587 (ITPR3)
   04918 Thyroid hormone synthesis
    102475587 (ITPR3)
   04928 Parathyroid hormone synthesis, secretion and action
    102475587 (ITPR3)
   04924 Renin secretion
    102475587 (ITPR3)
   04925 Aldosterone synthesis and secretion
    102475587 (ITPR3)
   04927 Cortisol synthesis and secretion
    102475587 (ITPR3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102475587 (ITPR3)
  09154 Digestive system
   04970 Salivary secretion
    102475587 (ITPR3)
   04971 Gastric acid secretion
    102475587 (ITPR3)
   04972 Pancreatic secretion
    102475587 (ITPR3)
  09156 Nervous system
   04724 Glutamatergic synapse
    102475587 (ITPR3)
   04725 Cholinergic synapse
    102475587 (ITPR3)
   04728 Dopaminergic synapse
    102475587 (ITPR3)
   04726 Serotonergic synapse
    102475587 (ITPR3)
   04720 Long-term potentiation
    102475587 (ITPR3)
   04730 Long-term depression
    102475587 (ITPR3)
   04723 Retrograde endocannabinoid signaling
    102475587 (ITPR3)
  09157 Sensory system
   04742 Taste transduction
    102475587 (ITPR3)
   04750 Inflammatory mediator regulation of TRP channels
    102475587 (ITPR3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102475587 (ITPR3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102475587 (ITPR3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102475587 (ITPR3)
   05012 Parkinson disease
    102475587 (ITPR3)
   05014 Amyotrophic lateral sclerosis
    102475587 (ITPR3)
   05017 Spinocerebellar ataxia
    102475587 (ITPR3)
   05020 Prion disease
    102475587 (ITPR3)
   05022 Pathways of neurodegeneration - multiple diseases
    102475587 (ITPR3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102475587 (ITPR3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102475587 (ITPR3)
   05163 Human cytomegalovirus infection
    102475587 (ITPR3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102475587 (ITPR3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tup01009]
    102475587 (ITPR3)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:tup04040]
    102475587 (ITPR3)
Protein phosphatases and associated proteins [BR:tup01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102475587 (ITPR3)
Ion channels [BR:tup04040]
 Ligand-gated channels
  IP3 receptor
   102475587 (ITPR3)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans SopA
Other DBs
NCBI-GeneID: 102475587
NCBI-ProteinID: XP_014441661
LinkDB
Position
Un
AA seq 2661 aa
MSEMSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDNPPKKFRDCLFKVC
PMNRYSAQKQYWKAKQTKQDKEKIADVVLLQKLQHAAQMEQKQNDTENKKVHGDVVKYGS
VIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDATGNEGSWLFIQPFWKLRSNGDNVVVG
DKVILNPVNAGQPLHASNYELSDNAGCKEVNSVNCNTSWKVNLFMQFRDHLEEVLKGGDV
VRLFHAEQEKFLTCDEYKGKLQVFLRTTLRQSATSATSSNALWEVEVVHHDPCRGGAGHW
NGLYRFKHLATGNYLAAEENPSYKGDVADPKAAGLGAQGRAGRRNAGEKIKYRLVAVPHG
NDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNVPIDIEEERPIRLMLGTC
PTKEDKEAFAIVSVPVSEIRDLDFANDASSMLASAVEKLNEGFISQNDRRFVIQLLEDLV
FFVSDVPNNGQNVLDIMVTKPNRERQKLMREQNILKQIFGILKAPFRDKGGEGPLVRLEE
LSDQKNAPYQHMFRLCYRVLRHSQEDYRKNQEHIAKQFGMMQSQIGYDILAEDTITALLH
NNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNHIAIPVTQELICKCVLDPK
NSDILIQTELRPVKEMAQSHEYLSIEYSEEEVWLTWTDKNNEHHEKSVRQLAQEARAGNA
HDENVLSYYRYQLKLFARMCLDRQYLAIHEISQQLGVDLIFLCMADEMLPFDLRASFCHL
MLHVHVDRDPQELVTPVKFARLWTEIPTAITIKDYDSNLNASRDDKKNKFASTMEFVEDY
LNNVVSEAVPFANEEKNKLTFEVGWAQRGPVCRAAQXXXXXXXCVQAPAAVLQAYEDASG
KNVRRSIQGVGHMMSTMVLSRKQSVFGAPSLPAGARAPEPLDRSKFEDNEDIVVMETKLK
ILEILQFILNVRLDYRISYLLSVFKKEFVEVFPMQDSGADGTAPAFDSTTANMNLDRIGE
QAEAMFGVGKTSSMLEVDDEGGRMFLRVLIHLTMHDYAPLVSGALQLLFKHFSQRQEAMH
TFKQVQLLISAQDVENYKVIRSELDRLRTMVEKSELWVDKKGSGKGEEVGAAAAKDKKER
PTDEEGFLPPPGEKSSENYQIVKGILERLNKMCGVGEQMRKKQQRLLKNMDAHKVMLDLL
QIPYDKGDAKMLELLRYAHQFLQKFCAGNPGNQALLHKHLHLFLTPGLLEAETMQHIFLN
NYQLCSEIGEPVLQHFVHLLATHGRHVQYLDFLHTVIKAEGKYVKKCQDMVMTELTNAGD
DVVVFYNDKASLAHLLDMMKAARDGVEDHSPLMYHISLVDLLAACAEGKNVYTEIKCTSL
LPLEDVVSVVTHEDCITEVKMAYVNFVNHCYVDTEVEMKEIYTSNHIWTLFENFTLDMAR
VCSRREKRLADPTLEKYVLTVVLDTVNAFFSSPFSENSTSLQTHQTIVVQLLQSTMRLLE
CPWLQQQHKGSVEACIRTLAMVAKSRAILLPMDLDAHISSLLSSGASCVAAAQRNASSYK
TATRAFPRVTPTANQWDYKNIIEKLQDIITALEERLKPLVQAELSVLVDVLHWPELLFLE
GSEAFQRCESGGFLSKLIQHTKDLVESEEKLCIKVLRTLQQMLLKKAKYGDRGNQLRKML
LQNYLQNRKSSSKSDLPDPAGTGLDQDWSAIAATQCRLDKEGATKLVCDLITSTKNEKIF
QESIGLAIRLLDGGNTEIQKSFYNLMMSDKKSERFFKVLHDRMKRAQQETKSTVAVNMND
LGSQPREDREPVDPTTKGRVASFSMPGASSRYSLGPSPRRGHEVSERVQSNEMGTSVLIM
QPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDIMCGSTTGGLGLLGLYIN
EDNVGLVMQTLETLTEYCQGPCHENQTCIVTHESNGIDIITALILNDISPLCKYRMDLVL
QLKDNASKLLLALMESRHDSENAERILISLRPQELVDVIKKAYQQEEERENSEVSPREVG
HNIYILASQLSRHNKQLQHLLKPVKRIQEEEAEGISSMLSLNNKQLSQMLKSSAPAQEEE
EDPLAYYENHTSQIEIVRQDRSMEQIVFPVPGICQFLTEETKHRLFTTTEQDEQGSKVSD
FFDQSSFLHNEMEWQRKLRSMPLIYWFSRRMTLWGSISFNLAVFINIIIAFFYPYVEGTS
TGVLGSPLISLLFWILICFSVAALFTKRYSIRPLIVALVLRSIYYLGIGPTLNILGALNL
TNKIVFVVSFVGNRGTFIRGYKAMVMDMEFLYHVGYILTSVLGLFAHELFYSILLFDLIY
REETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFILEVDRLPGNHSRAS
PLGMPHGAAAFVGTCSEDKVNCISGVSVPEVLEEDEELDSTERACDTLLMCIVTVMNHGL
RNGGGVGDILRKPSKDESLFPARVVYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQKK
EEILKTTCFICGLERDKFDNKTVSFEEHIKLEHNMWNYLYFIVLVRVKNKTDYTGPESYV
AQMIKNKNLDWFPRMRAMSLVSNEGEGEQNEIRILQDKLNSTMKLVSHLTAQLNELKEQM
TEQRKRRQRLGFVDVQNCMSR
NT seq 7986 nt   +upstreamnt  +downstreamnt
atgagcgaaatgtccagctttctccacatcggcgacatcgtctccctgtacgccgagggt
tccgtcaatggcttcatcagcactttggggctggtggatgaccgctgtgtggtggagccc
gcggcgggggacctggacaacccccctaagaagttccgagactgcctcttcaaggtgtgt
cccatgaaccgttactcggcccagaagcagtactggaaggccaagcagacgaagcaggac
aaggagaagatcgccgacgtggtgctgctgcagaagctgcagcacgcagcccagatggag
cagaagcagaacgacactgagaacaagaaggtgcacggggacgtcgtgaagtacggcagc
gtcatccagctcctgcacatgaaaagcaacaagtacctaacggtgaacaagcggctgccg
gccctgctggagaagaacgccatgcgggtgacgctggacgccacgggcaacgagggctcc
tggctcttcatccagcccttctggaagctgcggagcaacggggacaacgtggtcgtgggg
gacaaggtgatcctgaatcctgtcaacgccgggcagcccctgcatgccagcaattacgag
ctgagtgacaacgccggctgcaaggaggtcaactccgtgaactgcaacaccagctggaag
gtcaacctgttcatgcagttccgggaccacctggaggaggtgctgaaagggggagacgtg
gtgcggctgttccacgcggagcaggagaagttcctgacctgtgacgagtacaagggcaag
ctgcaggtgttcctgcgcaccacgctgcgccagtccgccacctcggccaccagctccaac
gccctctgggaggtggaggtggtccaccacgacccatgccgcggaggagctggccactgg
aacggcctgtaccgcttcaagcacctggccacgggcaactacctggctgctgaggagaac
cccagctacaaaggggatgtcgctgatcccaaggcagcaggactgggtgcccagggccgc
gcaggccgcaggaacgctggcgagaagatcaagtaccgcctggtggccgtgccccacggc
aacgacatcgcctctctctttgagctggaccccaccaccctgcagaaaaccgattccttc
gtgccacggaactcctacgtccggctgcggcacctctgcaccaacacgtggatccagagc
accaacgtgcccatcgacatcgaggaggagcggcccatccggctcatgctgggcacctgc
cccaccaaggaggacaaggaggcctttgccattgtgtcagtgcccgtgtccgagatccgc
gacctggactttgccaacgacgccagctccatgttggccagtgccgtggagaagctcaac
gagggcttcatcagccagaacgaccgcaggtttgtcatccagctgctggaggacctggtg
ttcttcgttagcgatgtccccaacaacgggcagaacgtcctggacatcatggtcaccaag
cccaaccgggagcggcagaagctgatgcgggagcagaacatcctcaaacagatctttggc
attctgaaggccccgtttcgagacaaggggggtgagggcccgctggtgcgcctggaggag
ctgtcggaccagaagaacgccccctaccagcacatgttccgcctctgctaccgcgtgttg
cggcattcccaggaggactaccgcaagaaccaggagcacatcgccaagcagttcgggatg
atgcagtcccagatcggctacgacatcctggccgaggacaccatcaccgcgctgctgcac
aacaaccgcaagctgctggagaagcacatcaccaagaccgaggtggagaccttcgtcagc
ctcgtgcggaagaaccgcgagcccaggttcctggactacctctccgacctgtgcgtgtcc
aaccacatcgccatccccgtcacccaggagctcatctgcaagtgtgtgctggaccccaag
aacagcgacatcctcatccagaccgagctccggcccgtgaaggaaatggcgcagtcccac
gagtacctgagcatcgagtactcggaggaggaggtgtggctcacctggaccgacaagaac
aacgagcaccacgagaagagcgtgaggcagctggcccaggaggcgcgggccggcaacgcc
cacgacgagaacgtgctcagctattacaggtaccagctgaagctctttgcccgcatgtgc
ctggaccgccagtacctggccatccacgagatctcgcagcagctgggcgtcgacctgatc
ttcctctgcatggctgacgagatgctgcccttcgacctgcgcgcctccttctgccacctg
atgctgcacgtgcacgtggaccgcgacccccaggagctggtcacgccggtcaagttcgcg
cgcctctggaccgagatccccacagccatcaccatcaaggactatgactccaacctcaat
gcctcccgagatgacaagaagaacaagtttgccagcaccatggagttcgtggaggactac
ctcaacaacgtggtcagcgaggccgtgccctttgccaacgaggagaagaacaagctcacc
ttcgaggtgggctgggctcagcggggtccagtctgcagggctgcccagnnnnnnnnnnnn
nnnnnnnnntgcgtgcaggcgcccgccgccgtgctgcaggcctatgaggacgccagcggc
aagaacgtgcggaggtccatccagggcgtggggcacatgatgtccaccatggtgctgagc
cgcaagcagtccgtgtttggggcccccagcctgcccgccggcgcccgtgcccccgagccg
ctggacagaagcaagttcgaggacaacgaggacatcgtggtgatggagaccaagctgaag
attctggaaattctgcagttcatcctcaacgtccgcctggactaccgaatctcctacctg
ctgtccgtcttcaagaaggagttcgtggaggtgttccccatgcaggacagcggggccgac
ggcacagcccccgccttcgactccaccactgccaacatgaacctggaccgcatcggggag
caggcggaggccatgtttggagtcgggaagaccagcagcatgctggaggtggacgacgag
ggcggccgcatgttcctgcgggtgctcatccacctgaccatgcacgactacgcgccgctg
gtctcgggggccctgcagctgctcttcaagcacttcagccagcgccaggaggccatgcac
accttcaagcaggtgcagctgctgatctcggcccaagacgtggagaactataaggtgatc
aggtccgagctggaccggctgcgcaccatggtggagaagtcggagctgtgggtggacaag
aagggcagcggcaagggcgaggaggtgggggcggccgccgccaaggacaagaaggagaga
cccaccgatgaggaggggtttctgccaccgcccggggagaagagcagcgagaactaccag
atcgtcaagggcatcctggaacggctgaacaagatgtgcggggtcggcgagcagatgagg
aagaagcagcagcgcctgctcaagaacatggatgcccacaaggtcatgctggacctgctg
cagatcccctacgacaagggtgacgccaagatgctggagctcctgcgctacgcacaccag
ttcctgcagaagttctgcgcggggaaccccggcaaccaggccctgctgcacaagcacctg
cacctcttcctcacgccggggctcctggaggcggagaccatgcagcacatcttcctcaac
aactaccagctgtgctcggagatcggcgagcccgtgctgcagcacttcgtgcacctgctg
gccacccacgggcgccacgtgcagtacctggacttcctgcacaccgtcatcaaggccgag
ggcaagtacgtcaagaagtgccaggacatggtcatgaccgagctgaccaacgcaggtgac
gacgtggtggtgttctacaacgacaaggcctcgctggcccacctgctggacatgatgaag
gcggcccgcgacggcgtggaggaccacagcccgctcatgtaccacatctcgctggtggac
ctgctggccgcctgcgccgagggcaagaatgtctacacggaaatcaagtgcacctctctg
ctgccgctggaggacgtggtgtccgtggtgacgcacgaggactgcatcaccgaggtgaag
atggcctacgtgaacttcgtgaaccactgttacgtggacacggaggtggagatgaaggag
atctacaccagcaaccacatctggaccctcttcgagaacttcaccctggacatggctcgg
gtctgcagtcggcgggagaagcgcctggctgaccccaccctggagaagtacgtcctcacc
gtcgtgctggacaccgtgaatgccttcttcagctccccgttctcggagaacagcacgtcc
ctgcagactcaccagacgatcgtggtgcagctgctgcagtccaccatgcggctgctcgag
tgtccgtggctgcagcagcagcacaagggctctgtggaggcctgcatccggaccctcgcc
atggtggccaagagccgggccatcttgctgcccatggacctggacgcccacatcagctcg
ctgctcagcagtggggccagctgtgtggccgccgcccagcggaacgcttccagctacaag
acggccactcgggctttcccccgcgtcacccccactgccaaccagtgggactacaagaac
atcattgagaagctgcaggacatcatcacggccctggaggagcggctgaagcccctggtg
caggccgagctgtcggtactggtggatgtcctgcactggccggagctgctgttcctggag
ggcagcgaggccttccagcgctgtgagagcgggggcttcctgtccaagctgatccagcac
accaaggaccttgtggagtcggaagagaaactgtgcatcaaggtgctgcggaccctgcag
cagatgctgctcaagaaggccaagtacggggaccggggcaaccagcttcgcaagatgctg
ctacaaaactacctccagaaccggaagtccagctccaagagcgaccttccggaccccgcg
ggcaccggcctggaccaggactggtcagcaatcgcggccacccaatgccggctggacaag
gagggggccaccaagctggtgtgtgacctcatcaccagcaccaagaacgagaagatcttc
caggagagcatcggcctggccatccgcctgctggacggcggcaacaccgagatccagaaa
tccttctacaacctgatgatgagcgacaagaagtcggagcgcttcttcaaggtgctgcac
gaccgcatgaagcgggcccagcaggagaccaagtccacggtggccgtcaacatgaacgac
ctgggcagccagccccgggaggaccgcgagccggtggaccccaccaccaaaggccgcgtg
gcctccttctcaatgcccggagcctcatcccgctactcgctgggccccagcccgcgccgg
gggcacgaggtgagcgagcgtgtgcagagcaacgagatgggcacgtctgtgctcatcatg
cagcccatcctgcgcttcctgcagctgctgtgcgagaaccacaaccgggacctgcagaac
ttcctgcgctgtcagaacaacaagaccaactacaacctggtgtgcgagacgctgcagttc
ctggacatcatgtgcggcagcaccactgggggcctggggctgctggggctctacatcaat
gaggacaacgtgggcctggtcatgcagaccctggagaccctcaccgagtactgccagggc
ccctgccacgagaaccagacctgcatcgtgacccacgagtccaacggcatagacatcatc
acagccctgatcctcaatgacatcagccccctgtgcaagtaccgcatggacctggtgctg
cagctcaaggacaatgcctccaagctgctgctcgccctgatggagagccggcatgacagc
gaaaacgccgaacgcatcctcatcagcctgcggccccaggagctggtggatgtcatcaag
aaggcctaccagcaggaggaggagcgtgagaactcagaggtgagcccacgcgaagtgggc
cacaacatctacatcttggcctctcagctctccagacacaacaagcagctgcagcacctg
ctgaagccggtgaagcgcatccaagaggaggaggctgagggcatctcctccatgctcagc
ctcaacaacaagcagctgtcccagatgctcaagtcctcggccccagcgcaggaggaggag
gaggaccccctggcctactacgagaaccacacgtcccagatcgagattgtgcggcaggac
cgcagcatggagcagatcgtgttcccagtgcccggcatctgccagttcctgacggaggag
accaagcacaggctcttcaccaccaccgagcaggacgagcagggcagcaaagtgagcgac
ttcttcgaccagtcctccttcctgcacaacgagatggagtggcagcgcaagctccgcagc
atgccgctcatctactggttctcccgccgcatgaccctgtggggcagcatctccttcaac
ctggcggtgttcatcaacatcatcatcgccttcttctacccttacgtggagggcacgtcc
accggcgtgctgggctccccactcatctcgctgctgttctggatcctcatctgcttctcc
gtggcggcgctgttcaccaagcgctacagcatccgccccctcattgtggccctcgtcctg
cgctccatctactacctgggcatcgggcccacactcaacatcctgggcgccctcaacctg
accaacaagatcgtgtttgtggtgagcttcgtgggaaaccggggcaccttcatccggggc
tacaaggccatggtcatggacatggaattcctctaccacgtgggctacatcctcaccagt
gtcctgggcctcttcgcccatgagctcttctacagcatcctgctctttgacctcatctac
cgcgaggagacgctgttcaacgtcatcaagagcgtgacccgcaatggccgctccatcttg
ctgaccgccctgctggccctcatcctggtctacctcttctccatcgtggggttcctcttt
ctcaaggatgacttcatcctcgaggtggaccggctgcctggcaaccactccagagccagc
cccctggggatgccacacggagctgccgcttttgtgggcacctgcagtgaggacaaggtg
aactgtatctcgggggtctccgtgcctgaggtcctggaagaggacgaggagctggacagc
acggagcgggcctgtgacactctgctgatgtgcatcgtcaccgtcatgaaccacgggctg
cgcaatggtggcggcgtaggcgacattctccgcaaaccctccaaagacgaatcccttttc
ccggcccgtgtggtctacgacctcctgttcttcttcatcgtcatcatcatcgtgctgaac
ctcatctttggggtgatcatcgacaccttcgctgacctgcgcagtgaaaagcagaagaag
gaggagattctcaagacgacctgcttcatctgcggtctggagagggacaagttcgacaac
aagacggtgtcgttcgaggagcacatcaagctggagcacaacatgtggaactacctgtac
ttcatcgtgctggtccgcgtgaagaataagacggactacacgggccccgagagctacgtg
gcccagatgatcaagaacaagaacctggactggttcccgcgcatgcgggccatgtccctg
gtgagcaatgaaggcgagggggagcagaatgagatccggattcttcaggacaagctcaat
tccaccatgaagctggtgtcccacctcaccgcccagctcaacgagctcaaggagcagatg
acggagcagcggaaacgcaggcaacgcctaggctttgtggacgtccagaactgcatgagc
cgctga

KEGG   Tupaia chinensis (Chinese tree shrew): 102482868
Entry
102482868         CDS       T02978                                 

Gene name
ITPR2
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 2
  KO
K04959  inositol 1,4,5-triphosphate receptor type 2
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04020  Calcium signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04070  Phosphatidylinositol signaling system
tup04114  Oocyte meiosis
tup04210  Apoptosis
tup04218  Cellular senescence
tup04270  Vascular smooth muscle contraction
tup04371  Apelin signaling pathway
tup04540  Gap junction
tup04611  Platelet activation
tup04621  NOD-like receptor signaling pathway
tup04625  C-type lectin receptor signaling pathway
tup04720  Long-term potentiation
tup04723  Retrograde endocannabinoid signaling
tup04724  Glutamatergic synapse
tup04725  Cholinergic synapse
tup04726  Serotonergic synapse
tup04728  Dopaminergic synapse
tup04730  Long-term depression
tup04750  Inflammatory mediator regulation of TRP channels
tup04912  GnRH signaling pathway
tup04915  Estrogen signaling pathway
tup04918  Thyroid hormone synthesis
tup04921  Oxytocin signaling pathway
tup04922  Glucagon signaling pathway
tup04924  Renin secretion
tup04925  Aldosterone synthesis and secretion
tup04927  Cortisol synthesis and secretion
tup04928  Parathyroid hormone synthesis, secretion and action
tup04929  GnRH secretion
tup04934  Cushing syndrome
tup04935  Growth hormone synthesis, secretion and action
tup04970  Salivary secretion
tup04971  Gastric acid secretion
tup04972  Pancreatic secretion
tup05010  Alzheimer disease
tup05012  Parkinson disease
tup05017  Spinocerebellar ataxia
tup05020  Prion disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05163  Human cytomegalovirus infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05170  Human immunodeficiency virus 1 infection
tup05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102482868 (ITPR2)
   04020 Calcium signaling pathway
    102482868 (ITPR2)
   04070 Phosphatidylinositol signaling system
    102482868 (ITPR2)
   04022 cGMP-PKG signaling pathway
    102482868 (ITPR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102482868 (ITPR2)
   04210 Apoptosis
    102482868 (ITPR2)
   04218 Cellular senescence
    102482868 (ITPR2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102482868 (ITPR2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102482868 (ITPR2)
   04621 NOD-like receptor signaling pathway
    102482868 (ITPR2)
   04625 C-type lectin receptor signaling pathway
    102482868 (ITPR2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102482868 (ITPR2)
   04929 GnRH secretion
    102482868 (ITPR2)
   04912 GnRH signaling pathway
    102482868 (ITPR2)
   04915 Estrogen signaling pathway
    102482868 (ITPR2)
   04921 Oxytocin signaling pathway
    102482868 (ITPR2)
   04935 Growth hormone synthesis, secretion and action
    102482868 (ITPR2)
   04918 Thyroid hormone synthesis
    102482868 (ITPR2)
   04928 Parathyroid hormone synthesis, secretion and action
    102482868 (ITPR2)
   04924 Renin secretion
    102482868 (ITPR2)
   04925 Aldosterone synthesis and secretion
    102482868 (ITPR2)
   04927 Cortisol synthesis and secretion
    102482868 (ITPR2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102482868 (ITPR2)
  09154 Digestive system
   04970 Salivary secretion
    102482868 (ITPR2)
   04971 Gastric acid secretion
    102482868 (ITPR2)
   04972 Pancreatic secretion
    102482868 (ITPR2)
  09156 Nervous system
   04724 Glutamatergic synapse
    102482868 (ITPR2)
   04725 Cholinergic synapse
    102482868 (ITPR2)
   04728 Dopaminergic synapse
    102482868 (ITPR2)
   04726 Serotonergic synapse
    102482868 (ITPR2)
   04720 Long-term potentiation
    102482868 (ITPR2)
   04730 Long-term depression
    102482868 (ITPR2)
   04723 Retrograde endocannabinoid signaling
    102482868 (ITPR2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102482868 (ITPR2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102482868 (ITPR2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102482868 (ITPR2)
   05012 Parkinson disease
    102482868 (ITPR2)
   05017 Spinocerebellar ataxia
    102482868 (ITPR2)
   05020 Prion disease
    102482868 (ITPR2)
   05022 Pathways of neurodegeneration - multiple diseases
    102482868 (ITPR2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102482868 (ITPR2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102482868 (ITPR2)
   05163 Human cytomegalovirus infection
    102482868 (ITPR2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102482868 (ITPR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:tup04040]
    102482868 (ITPR2)
Ion channels [BR:tup04040]
 Ligand-gated channels
  IP3 receptor
   102482868 (ITPR2)
SSDB
Motif
Pfam: RYDR_ITPR Ins145_P3_rec MIR RIH_assoc Ion_trans DUF2207 Sec2p
Other DBs
NCBI-GeneID: 102482868
NCBI-ProteinID: XP_006140375
LinkDB
Position
Un
AA seq 2767 aa
MLLIFTASFYEFEKDASIGFGDCSVLTYCYAGQMEPVPLHSTLTAELTTKLQNVFCYRLK
LNIVEAWICFHLTQCDFLFLRKQFLKTLERNFSHALQLLLVDDRCVVHPEAGDLANPPKK
FRDCLFKVCPMNRYSAQKQYWKAKQAKQGNHTEAALLKKLQHAAELEQKQNESENKKLLG
EIVKYSNVIQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDAAGNEGSWFYIHPFWKLRSE
GDNIVVGDKVVLMPVNAGQPLHASNIELLDNPGCKEVNAVNCNTSWKITLFMKYSSYRED
VLKGGDVVRLFHAEQEKFLTCDEYEKKQHIFLRTTLRQSATSATSSKALWEIEVVHHDPC
RGGAGQWNSLFRFKHLATGNYLAAELNPDYRDAQNEGKNVRDGDLPTSKKKRQAGEKIMY
TLVSVPHGNDIASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTSIPIDTDEERP
VMLKIGTCQTKEDKEAFAIVSVPLSEVRDLDFANDANKVLATTVKKLENGTITQNERRFV
TKLLEDLIFFVADVPNNGQEVLDVVITKPNRERQKLMREQNILAQVFGILKAPFKEKAGE
GPMLRLEDLGDQRYAPYKYMLRLCYRVLRHSQQDYRKNQEYIAKNFCVMQSQIGYDILAE
DTITALLHNNRKLLEKHITAKEIETFVSLLRRNREPRFLDYLSDLCVSNTTAIPVTQELI
CKFMLSPGNADILIQTKVVSMQADNPLESSLLPDDIDDEEVWLYWIDSNKEPHGKAIRHL
AQEAKEGTRADLEVLTYYRYQLNLFARMCLDRQYLAINQISTQLSVDLILRCMSDESLPF
DLRASFCRLMLHMHVDRDPQESVVPVRYARLWTEIPTKITIHEYDSITDSSRNDMKRKFA
LTMEFVEEYLKEVVNQPFPFGDKEKNKLTFEVVHLARNLIYFGFYSFSELLRLTRTLLAI
LDIVQAPMSSYFERLSKFQDGGNNVMRTIHGVGEMMTQMVLSRGSIFPMSVPDVQPSIHP
SKQGSPTEHEDVTVMDTKLKIIEILQFILSVRLDYRISYMLSIYKKEFGENSENAESAGG
PPDTLLPSAIVPDIDEIAAQAETMFAGRKEKNPVQLDDEGGRTFLRVLIHLIMHDYPPLL
SGALQLLFKHFSQRAEVLQAFKQVQLLVSNQDVDNYKQIKADLDQLRLTVEKSELWVEKS
SSYENGEMSENQVKGGEEPIEESNILSPVQDGTKKPQIDSNKSNNYRIVKEILIRLSKLC
VQNKKCRSQHQRLLKNMGAHSVVLDLLQIPYEKNDEKMNEVMNLAHTFLQNFCRGNPQNQ
ALLHKHLNLFLTPGLLEAETMRHIFMNNYHLCNEISERVVQHFVHCIETHGRHVEYLRFL
QTIIKADGKYVKKCQDMVMTELINGGEDVLIFYNDRASFPILLHMMCSERDRGDESGPLA
YHITLVELLAACTEGKNFYTEIKCNSLLPLDDIVRVVTHDDCIPEVKIAYVNFVNHCYVD
TEVEMKEIYTSNHIWKLFENFLVDMARVCNTTTDRKHADIFLERCVTESIMSIVSGFFNS
PFSDNSTSLQTHQPVFIQLLQSAFRIYNCTWPNPAQKASVESCIRTLAEVAKNRGIAIPV
DLDSQVNTLFMKSHSNMVQRAAMGWRLSARSGPRFKEALGGPAWDYRNIIEKLQDVVASL
EQQFSPMMQAEFSVLVDVLYSPELLFPEGSDARIRCGAFMSKLINHTKKLMEKEEKLCIK
ILQTLREMLEKRDSFMEEGNTLRKILLNRYFKGEYGSGMNGHLSGSYSKTAQGGGGFSGQ
DSDKTGTSMSDIQCLLDKEGASELVIDVIVNTKNDRIFSEGILLGIALLEGGNTQTQYSS
YQQLHEQKKSEKFFKVLYDRMKAAQKEIRSTVTVNTTDLGSKKRDDDNEVMPSGPRMRVR
DSPLHLKEGMKGQLTEASSATSKAYCVYRREMDPEIDIMCTGPEVGNAEDKSAEEVTMSP
VIAIMQPILRFLQLLCENHNRELQNFLRNQNNKTNYNLVCETLQFLDCICGSTTGGLGLL
GLYINEKNVALVNQTLESLTEYCQGPCHENQTCIATHESNGIDIIIALILNDINPLGKYR
MDLVLQLKNNASKLLLAIMESRHDSENAERILFNMRPRELVDVMKNAYNQGLECDHGDDE
GGDGVSPKDVGHNIYILAHQLARHNKLLQQMLKPGSDPDEGDEALKYYANHTAQIEIVRH
DRTMEQIVFPVPNICEYLTRESKCRVFNTTERDEQGSKVNDFFQQTEDLYNEMKWQKKIR
SNQALFWFSRHISLWGSISFNLAVFINLAVALFYPFGDDGDEGTLSPLFSVLLWIAVAIC
TSMLFLFSKPVGIRPFLVSIMLRSIYTIGLGPTLILLGAANLCNKIVFLVSFVGNRGTFT
RGYRAVILDMAFLYHVTYVLVCMLGLFVHEFFYSFLLFDLVYREETLLNVIKSVTRNGRS
IILTAVLALILVYLFSIIGFLFLKDDFTMEVDRLKNRTPVTGSYGVPTMTLPSFISTCEK
ENCSPTIPASNTADEEYEDGIERTCDTLLMCIVTVLNQGLRNGGGVGDVLRRPSKDEPLF
AARVVYDLLFYFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDN
KTVSFEEHIKSEHNMWHYLYFIVLVKVKDPTEYTGPESYVAQMIVEKNLDWFPRMRAMSL
VCNEGDSEQNEIRNLQEKLESTMSLVKQLSGQLAELKEQMTEQRKNKQRLGFLGSNTPHV
NHHMPPH
NT seq 8304 nt   +upstreamnt  +downstreamnt
atgctgttgatatttacggcttctttctatgaatttgaaaaagatgcctccattggcttc
ggagactgttctgtgctgacgtactgctatgcagggcagatggagcctgtaccactgcat
tcgactctgacagcagagcttaccaccaaactccagaacgtcttttgttacaggctgaaa
ctgaacattgtggaagcttggatttgctttcacttgacccaatgtgatttcctgtttcta
agaaaacagtttctaaagactcttgaaaggaatttctcccatgccttgcagctcttgtta
gtggatgacagatgtgtggtacatccagaggcaggggaccttgccaaccctcccaagaag
ttcagagactgccttttcaaggtgtgccctatgaaccgatattctgcccagaagcaatat
tggaaagccaagcaagccaaacaggggaaccacacagaggcagccttgctgaagaaactg
cagcatgctgcagaactggaacaaaaacaaaatgaatctgagaacaagaaactgttggga
gaaattgtgaaatacagtaatgttatacaactactgcacataaaaagcaataaatatctg
actgtcaacaagagattacccgctttgctggagaagaatgccatgcgtgtgtccttggat
gctgcgggaaacgaagggtcttggttttatattcatcccttctggaagctgagaagcgag
ggtgacaacatcgttgtgggagataaagttgttttgatgcccgtgaacgcaggacaacca
ctacatgccagcaacatagagcttctcgataatccaggctgtaaagaggtgaatgctgtt
aattgcaacactagctggaaaatcaccttattcatgaagtacagttcctatcgagaagat
gtattgaaaggaggtgatgtggttagactgtttcatgctgaacaagagaagtttctgact
tgtgacgaatatgagaagaaacagcacattttccttcgcacaaccttgcgccaatcagca
acttccgctactagttctaaagcactctgggaaatagaggtggttcatcatgacccatgc
cgtgggggtgcaggacaatggaacagcttgttcaggtttaaacatcttgcaactgggaac
tatttagctgcagagcttaatcctgattaccgagatgcacaaaatgaaggaaaaaatgtg
agagatggagaccttccaacttcaaagaaaaaacgccaggcaggggagaagatcatgtac
actttggtctcagtcccacacggaaatgacattgcatccctttttgaactggatgccaca
actctacagagagctgactgtctggtaccaaggaactcatatgttcggttaagacactta
tgcacaaatacatgggtaactagtactagtatacccattgacacagatgaagagaggcct
gttatgttgaagattggaacatgccaaactaaagaagataaagaagcatttgccattgtg
tctgtcccactctctgaggtccgagacttggactttgccaatgatgcgaataaagtgtta
gcaaccacagttaaaaaactggaaaatggcacaattacacagaatgaaaggaggtttgtc
accaaattattagaggacctcatcttctttgttgctgatgtgcctaataatggacaagaa
gttctggatgtggttatcactaagccaaaccgagaacgccaaaagttaatgagggaacaa
aatatattggcgcaggtatttgggattcttaaagcaccctttaaggaaaaagcaggagaa
ggcccgatgctgagacttgaagatctaggggaccagagatatgctccctacaaatacatg
ctccgcctctgctaccgtgtgctgagacattcccagcaggactaccggaaaaatcaggaa
tatattgctaagaatttctgtgtcatgcagtcccagattggctatgatatcttggcagaa
gacactatcacagctttgttgcacaacaacagaaaactactagagaaacatattacagca
aaagaaatagagacatttgtcagtttactcaggagaaatcgggagccaagatttctggat
tatttgtctgatctatgtgtgtctaacacaacggctattcctgtaactcaggaactcatc
tgtaaatttatgctgagtccaggcaatgcagacattctcatccaaaccaaggtggtttct
atgcaagcagacaaccccttggagagctccctcctcccagatgacattgatgatgaagaa
gtttggctctattggattgacagcaacaaggagcctcatggcaaagccatcagacacctt
gctcaggaagcaaaagaaggcaccagagctgatttagaagttcttacctattacaggtac
caactaaacctctttgcaaggatgtgcttggaccgccagtatctggccataaaccagatt
tctacacagctttctgtagatttgatcttgcggtgtatgtcggatgagagcctgcctttt
gacctccgagcatctttctgtcgcctgatgctccacatgcacgttgaccgcgatccccag
gaatctgtggtgcctgttcgctatgccaggctctggacagaaatccccacaaagatcacg
attcatgaatatgattctataacagactcttccagaaatgacatgaagaggaaatttgca
ctgacaatggaatttgttgaagaatacttgaaagaagttgtaaatcagccctttcctttt
ggagataaagaaaaaaacaaactgacatttgaggtggtccacttggctcggaatcttata
tactttggattttatagtttcagtgagttattaaggctaacaagaacacttctggctatc
ctagatattgtacaggcccccatgtcatcgtactttgaaagactgagcaaatttcaggat
ggaggaaacaatgtcatgagaactatccatggggtgggagagatgatgactcagatggtt
ctgagcagaggctccatctttcccatgagtgtgcctgacgtgcagcccagcatccatccc
agcaagcaagggagccccactgaacacgaggacgtgaccgtgatggacaccaagctcaag
atcattgagatcttacagtttatcctgagtgtcagactagattataggatctcatacatg
ctgtcaatatacaagaaggagtttggagagaacagtgaaaatgctgagtctgccggcggc
cctccagatactttactgccatcagctattgttcctgacatagatgaaattgcagctcag
gcggaaaccatgtttgctggaagaaaggagaaaaatccagttcaacttgatgatgaagga
ggcaggacgtttttgcgggtcctcattcatctgatcatgcacgactaccctcctttgcta
tctggagccctgcagctactgttcaagcacttcagccagagggcggaagttttacaggca
tttaaacaggtgcagttactggtgtctaatcaagatgtagataactacaagcagatcaag
gctgatctagaccagcttcgactgacagtagaaaaatccgagttatgggttgagaagagc
agcagctatgagaatggagaaatgagtgaaaatcaagtaaaaggtggtgaagagccaatt
gaggaatcaaacattttaagtccagtgcaggatggaacaaagaaacctcagattgacagc
aacaaaagcaataactaccggattgtaaaagagattttgattaggctaagtaaactctgt
gtgcagaataaaaagtgtcggagtcaacatcaacgattactgaaaaacatgggtgctcac
tcggtggtgttggatcttctgcagataccctatgaaaagaatgatgaaaagatgaatgaa
gtaatgaatctagcccatacattcctgcagaatttctgcagaggaaatccacagaatcaa
gctcttcttcataaacatcttaatttgtttttaactcctggtctccttgaagcagagacc
atgcggcacatcttcatgaacaattaccacctgtgcaatgagattagtgaaagagtcgtg
cagcatttcgttcactgcatcgagacacacggccgccacgtggagtacctgaggtttctg
cagacgattataaaagcagatggtaaatacgtgaagaaatgccaggatatggtaatgaca
gagctgataaatgggggtgaagatgtgctgatattttacaacgacagagcatcatttcca
atccttctccatatgatgtgttcagagagagaccggggggacgagagcggccccttagcc
taccatatcaccctggtggaattgctggcagcatgcacagaggggaaaaatttttacact
gaaatcaagtgtaattcccttctgcccctggatgacatagtgagggtggtgacccacgat
gattgcatccccgaggttaaaattgcttatgtgaattttgttaatcactgctacgttgac
accgaagtggagatgaaggaaatctacaccagtaaccatatttggaaattatttgaaaac
ttcttggtagatatggccagggtctgcaacacaactacagacaggaagcacgcagacatt
ttcttggagaggtgtgtgactgagtcaataatgagcattgtgagcggcttctttaattct
cctttttcagacaacagtaccagcctccagacacatcagccagtctttattcagctgctg
caatctgccttcagaatttacaattgtacctggccaaacccagcacagaaagcctcagtg
gagtcctgcattaggactttggctgaagtggcaaaaaatcgtggcattgccattccagtg
gatttggacagccaagttaatacccttttcatgaagagccattcaaatatggtacagaga
gccgccatgggttggagactgtcagctcgctctggaccacgctttaaggaagctcttgga
ggacctgcttgggattacagaaatattattgaaaagttacaggatgtagtggcctccttg
gagcaacagttcagcccaatgatgcaggccgagttctcggtgctggtggatgtcttgtac
agtccagaactgctgttccctgaggggagtgatgcaagaataagatgtggtgcttttatg
tccaagttgattaatcacacaaagaaacttatggagaaagaagaaaaactgtgcattaaa
attctgcagacattacgagaaatgctagagaagagagacagctttatggaagagggtaac
acattaagaaaaatactcctgaatcgatactttaaaggcgaatatggaagtggtatgaat
ggacacctgtcgggatcctactccaaaactgcacaagggggaggaggcttttctggacaa
gattcggacaaaacggggacatcaatgtcagatattcagtgtctgctggataaagagggt
gcatctgaacttgtcattgatgtgatagtgaacaccaaaaatgacagaattttttcagaa
ggtattttacttggcatcgccttgcttgaaggaggaaatacacaaactcagtattcttcc
taccagcagttgcatgaacaaaaaaaatcagaaaaattcttcaaagttctctatgatcga
atgaaggctgctcagaaagagataagatcaacagtgacagttaataccacagatctaggt
agcaaaaaaagggatgatgacaatgaagtgatgccatctggccctcggatgagagtaaga
gattcaccattacatttaaaagagggaatgaaagggcaattaacagaagcgtcttcggca
acctccaaagcatactgtgtgtacagaagagagatggatcccgaaatagacattatgtgc
acaggaccagaagtggggaacgcagaggacaagtctgcagaggaagtgacgatgagccct
gtgatcgccatcatgcaaccaatactgcgatttctgcagttactgtgtgagaatcacaac
cgagaactgcagaacttcttgaggaatcaaaacaacaaaacaaattacaaccttgtctgt
gaaacccttcagtttttggactgcatttgtggaagtacaactgggggcttgggcctgttg
ggtctctacatcaatgagaagaatgtagcactggtcaaccagactctggagagcttgacg
gagtactgccagggcccatgccatgagaatcagacgtgtattgctactcatgaatctaat
gggattgacatcatcattgctttgattttaaatgatataaaccctcttggcaaataccga
atggacctggtgctccaactaaagaacaacgcctccaagctcttgctggccattatggaa
agcagacatgacagcgagaatgcagaaagaattctttttaacatgagacccagggaactg
gtggatgtgatgaagaatgcctacaaccaaggattggaatgtgatcatggggatgatgag
ggtggagatggtgtttccccaaaagatgtcggacacaatatctacattctggcccatcag
ttggcccgccacaataaactattacagcaaatgctcaagccgggatcggatccagatgaa
ggagatgaagccttgaagtattacgccaaccacaccgcccagatcgagattgttcggcat
gataggacgatggaacaaattgtttttcctgtccccaacatatgcgagtacctcactcga
gaatccaagtgccgcgtgttcaatacaactgaaagggatgaacaaggaagtaaagtgaat
gactttttccaacaaacagaagatctctacaatgaaatgaagtggcagaagaaaatcagg
agtaaccaggctctgttctggttctcaaggcacatctctctctggggcagcatctccttc
aacctggccgtgttcatcaatttagctgttgctctcttctacccatttggggatgatggc
gatgaaggtacactttctccattgttctccgttcttctttggatagcagtggccatctgt
acgtccatgctgtttttattctccaagcctgtgggtatacggccgtttcttgtgtccata
atgctaagatcaatatatacaataggtcttgggcctacattaatacttcttggtgcagct
aatctttgtaataaaatagtatttctcgtgagttttgttggaaatcgcggcacgttcacc
cgagggtaccgagcagtcatcctggatatggcctttctctatcacgtaacgtatgtcctg
gtttgcatgctgggcctctttgtccatgaattcttctatagcttcctgctttttgatttg
gtgtatagagaagagacactgctcaatgtcataaaaagtgtcacacgaaatggccgctct
attatcctgactgcagtcctggctctcatccttgtctacctgttttccattattggcttc
ctttttttgaaggatgacttcactatggaagtagataggctgaaaaacagaacccctgtt
acaggtagttacggcgtccccaccatgaccttaccttccttcattagcacatgtgaaaag
gagaactgctcgcccacgataccggcttccaatacagctgatgaagagtatgaagatgga
attgaaaggacatgtgacactctgcttatgtgcatcgtgactgtgctgaaccagggcctc
aggaatggtggcggtgtgggggacgtgctgagaaggccatcaaaagatgagcccttgttt
gctgctcgagtggtttatgaccttcttttttatttcattgttattattatcgttcttaac
ttgatctttggtgttatcattgatacctttgctgacctcagaagtgaaaagcagaaaaaa
gaagaaattctaaagacaacctgtttcatctgtggacttgaaagggacaagtttgataat
aaaacggtttcctttgaagagcacattaagtcagaacacaacatgtggcattatctatac
ttcatagtcctggtgaaagtcaaagatccaacagaatacactggacctgaaagttacgtg
gctcagatgattgtggagaagaatttggactggtttccccggatgcgagccatgtctctc
gtttgcaatgaaggcgacagtgagcaaaatgagattcggaaccttcaggagaagttagaa
tcaaccatgagtctggtcaaacagctgtcaggtcagctggcagagctcaaggaacagatg
acagaacaaaggaagaataagcagagactgggcttcctcggatcaaacacaccccatgtg
aatcatcacatgccaccacactga

DBGET integrated database retrieval system