KEGG   Tupaia chinensis (Chinese tree shrew): 102473653
Entry
102473653         CDS       T02978                                 

Gene name
RYR2
Definition
(RefSeq) ryanodine receptor 2
  KO
K04962  ryanodine receptor 2
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04020  Calcium signaling pathway
tup04024  cAMP signaling pathway
tup04260  Cardiac muscle contraction
tup04261  Adrenergic signaling in cardiomyocytes
tup04371  Apelin signaling pathway
tup04713  Circadian entrainment
tup04911  Insulin secretion
tup04921  Oxytocin signaling pathway
tup04972  Pancreatic secretion
tup05020  Prion disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05410  Hypertrophic cardiomyopathy
tup05412  Arrhythmogenic right ventricular cardiomyopathy
tup05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102473653 (RYR2)
   04020 Calcium signaling pathway
    102473653 (RYR2)
   04024 cAMP signaling pathway
    102473653 (RYR2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102473653 (RYR2)
   04921 Oxytocin signaling pathway
    102473653 (RYR2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102473653 (RYR2)
   04261 Adrenergic signaling in cardiomyocytes
    102473653 (RYR2)
  09154 Digestive system
   04972 Pancreatic secretion
    102473653 (RYR2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102473653 (RYR2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    102473653 (RYR2)
   05022 Pathways of neurodegeneration - multiple diseases
    102473653 (RYR2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102473653 (RYR2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102473653 (RYR2)
   05414 Dilated cardiomyopathy
    102473653 (RYR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:tup04040]
    102473653 (RYR2)
   04990 Domain-containing proteins not elsewhere classified [BR:tup04990]
    102473653 (RYR2)
Ion channels [BR:tup04040]
 Voltage-gated cation channels
  Ryanodine receptor
   102473653 (RYR2)
Domain-containing proteins not elsewhere classified [BR:tup04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   102473653 (RYR2)
SSDB
Motif
Pfam: RYDR_ITPR RyR RR_TM4-6 SPRY Ins145_P3_rec MIR RIH_assoc Ion_trans EF-hand_7 EF-hand_1 EF-hand_8 Apolipoprotein EF-hand_6 YjfB_motility
Other DBs
NCBI-GeneID: 102473653
NCBI-ProteinID: XP_014442288
LinkDB
Position
Un
AA seq 4986 aa
MLFHVEQHLPSRRGGSRREHGLRDDEVVLQSTAATHKEQQKLCLAAEGFGNRLCFLEPTS
NSKNVPPDLSVCTFVLEQSLSVRALQEMLACTVEKSEGQVDVEKWKFMMKTAQGGGHRTL
LYGHAILLRHSYSGMYLCCLSTSRSSTDKLAFDVGLQEDTTGEACWWTIHPASKQRSEGE
KVRVGDDLILVSVSSERYLHLSYGEGSLHVDAAFQQTLWSVAPISSGSEAAQGYLIGGDV
LRLLHGHMDECLTVPSGEHTGEQRRTVHYEGGAVSAHARSLWRLETLRVAWSGSHIRWGQ
PFRLRHVTTGKYLSLLEDRNLLLVDKEKADVKSTAFSFRSSKEKLDVGVRKEVDGMGASE
IKYGDSVCFIQHVDSGLWLTYQAVDMKSARRGSVQRKAIMHHEGHMDDGLNLSRSQHEES
RTARVIRSTVFLFNRFIRXLDRRSRKAKAPVDLPIESMSLSLQDLIGYFHPPDEHLEHED
KQNRLRALKNRQNLFQEEGMINLVLECVDRLHVYSSAAHFSDVAGREAGESWKSILNSLY
ELLAALIRGNRKNCAQFSGSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHI
KSIISLLDKHGRNHKVLDVLCSLCVCHGVAVRSNQHLICENLLPGRDLLLQTRLVNHVSS
MRPNIFLGVSEGSAQYRKWYYELTVDHTEPFVTAEATHLRVGWASTEGSSPYPGGGEEWG
GNGVGDDLFSYGFDGLHLWSGCVARTVSSPSQHLLRTEDVVSCCLDLSAPSISFRINGQP
VQGMFENFNVDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCYEAVLPKEKLKV
EHSREYKQERTSMRELLGPTVSLTQAGFTPAPVDTSQIVLPPHLERVREKLAENIHELWV
MNKIELGWQYGPVRDDNKRQHPCLVEFSKLPEQERNYNLQMSLETLKTLLALGCHVGLSD
EHAEEKVKRMKLPKNYQLSSAYKPAPMDLSFVKLSPSQEAMVDKLAENAHNVWARDRIRQ
GWTYGIQQDVKNRRNPRLVPYALLDERTKRSNKDSLREAVRTLLGHGCHLQAPDQDPAPR
AEVSSGTGERFRIFRAEKTYAVKAGRWYFEFEAVTAGDMRVGWSRPGCQPDRELGSDEQA
FAFDGLKAQRWHQGSEHYGRPWQAGDVVGCMVDMDEHTAVFTLNGEVLLDDSGSELAFKD
FDVRDGFIPVCSLGVGQVGRMNFGKDVSTLKYFTVCGLQEGYEPFAVNTNRDVTMWLSKR
LPQFLQVPSNHEHIEVTRIDGTVDSSPCLKVTQKSFGSQNSSPDIMFYRLSMPIECAEVF
SKTVVGGLPGTGLFGPKNDLEDYDADSDFEVLMKTAHGHLASDRADKDRDAAKLEVNNHK
DCAQEKPSRLRQRFLLRRTKPDYSASHSARLTEDVLADGRDDYDYLMQASTYYYSVRIFP
GQEPANVWVGWITSDFHQHDTVFDLDRVRTVTVTLGDEKGKVHESIKRSNCYMVCAGEGL
SPGQGRNSGGLEIGCMVDAASGLLTFMANGKELGTYYQVEPSTKLFPAVFAQATSPNVFQ
FELGRIKNVMPLSAGLFKSEHRNPVPQCPPRLHVQCLSHVLWSRMPNQFLKVDVARVSER
QGWLVQCADPLQFMTLHIPEENRSVDILELTEQEELLRFHYHTLRLYSAVCALGNHRAAH
ALCSHVDGPQLLYAIESKHMPGLLRAGYYDLLIDIHLRSYATARLAMDGEFIVPMTPDTK
SITLFPDARKRHGLPGIGLSTSLRPPMHFSAPGCVSVGHECFQHSPEFPLDVLKAKTMQM
LTEAVREGSLHARDPVGGTTEFLFVPLIKLFYTLLIMGVFHGEDLRHVLRLIEPRVFKDA
ADPSPEDEDEDGAHTPVEEPGADTSKPEGAGEDEGRGAPRPQEGLLQMKLPEPVKLQMCL
LLQHLCDCQVRHRIEAIVAFSDGFVAKLQDNQRFRYNEVMQALNMSAALTARKTKEFRSP
PQEQINMLLNFKDDKSECPCPEEIRDQLLDFHEDLMAHCGIELDEDGSLDGSSDSTIRGR
LLSLVEKVTYLKKKQAEKPVERNAKKPSSLQQLISETMVRWAQEAVIEDPELVRAMFVLL
HRQYDGIGGLVRALPKTYTINSVSVEDTVSLLASLGQIRSLLSVRMGREEEKLMIRGLGD
IMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEIAFPKMVANCCRFLCYFCRISR
QNQKAMFDHLSYLLENSSVGLASPAMRGSTPLDVAAASVMDNNELALALREPDLEKVVRY
LAGCGLQSCQLLVSRGYPDVGWNPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRP
ECFGPALRGEGGHGLLAAMEEAIKIAEDPSRDGPSPASGSSRTLDTEEGEDDTIHMGNAI
MTFYAALIDLLGRCAPEMHLIHAGKGEAIRIRSILRSLIPLGDLVGVISIAFQMPTLARD
GSVAEPDMSAGFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLPDLRAAASLDTAALS
ATDMALALNRYLCTAVLPLLTRCAPLFAGTERHASLIDSLLHTVYRLSKGCSLTKAQRDA
IEVCLLSICSQLRPSTMQHLLRRLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLSRGWG
SFGAASEEELHLSRKLFWGIFDALSQKKYEQELFKLALPCLSAVAGALPPDYMESSYVNT
LEKQSSVDAEGNFNPQPVDTSNITIPEKLECFINKYAEHTHDKWSVDKLANGWVYGEVYS
DSSKVQPLMKPYKLLSEKEKEIYRWPIKESLKTMLAWGWRIERTREGDSMALYNRARRIS
QTSQVSMDAAHGYSPRALDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKLELESKGGGSH
PLLVPYDTLTAKEKARDREKAQDILKFLQINGYAVSRGFQDLELDTPSVEKRFAYSLLQQ
LVHCVDAAHQHILEFDGGGRGQGGHFPHEQEVKFFAKVVLPLIDQYFKNHRLYFLSAASR
PLCSGGHASNKEKEMVTSLFCKLGVLVRHRISLFGNDATSIVNCLHILAQTLDARTVMKT
GLESVKSALRAFLDSAAEDLEQTLENLQQGQFTHTRSQPKGVTQIINYTTVALLPVLSSL
FEHVGQHQFGEDLILEDVQVSCYRILSSLYALGTSRSIYVERQRSALGECLAAFAGAFPV
AFLETHLNKHNAYSIYNTRSSRERAALSLPPSVEDVCPNIPSLDKLMADIVELAEAGTRY
PQAPHVVEVVLPMLCAYTSRWWERGPEGGTQGPEACCTALRAEHMDTLLGSILKIIYHNL
GVDEGAWMKRLAVFSQPIINKVKPQLLKTHFLPLMEKLKNKAAMVVADEDQLKAEARGDM
SEAELLILDDFTTLARDLYAFYPLLIRFVDYNRAKWLKEPNPEAEELFRMVAEVFIYWSK
SHNFKREEQNFVVQNEINNMSFLITDTKSKMSKAAVSDQERKKMKRKGDRYSLQTSLVVA
ALKRLLPVGLNICAPGDQELIALAKSRFSLKDTEDEVRDVIRSNIHTQGKLEDPAIRWQM
VLYKDLPNRTEDTSDPEKTVDRVLDMANVLFHLEQNSKTVARGCHSLVEHPQRSKKAVWH
KLLSKQRKRAVVACFRMAPLYNLPRHRAVNLFLQGYEKSWIEAEEHYFEDKLIEDLAKPG
ADLPEEDEGAKRVDPLHQLILLFSRTALTEKCKLEEDFLYMAYAGIMAKSCHDEEDEDGE
EEVKSFEVTGSQRSKEKEMEKQKLLYQQARLHDRGAAEMVLQTLSASKGDSGPMVAATLK
LGIAVLNGGNSTVQQKMLDYLKEKKDVGFFQSLAGLMQSCSVLDLNAFERHNKAEGLGMV
TEEGSGDKVLQDDEFTCDLFRFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLR
VQESISDFYWYYSGKDVIDEQGQRNFSKAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRL
WDAVVGFLHVFAHMQMKLSQDSSQIELLKELMDLQKDMVVTLLSMLEGNVVNGTIGKQMV
DMLVESSHNVEMILKFFDMFLKLKDLTSSDTFKECDPDGKGVISKRDFHRAMEGHKHYTP
SETEFLLSCAETDENETLDYEEFVKRFHEPAKDIGFNVAVLLTNLSEHMPHDPRLHTFLA
LAESALHYFQPFLGRIEIMGSAKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEG
GEKEKMELFVNFCEDTIFEMQLAAQISESDLNERSASKEDSERDRPEEQGPRPGFFSVLM
LRSALLALRYNLLVLLRLLSLKSLKKQVKRAKRMTVRDLLAALLASCWRLLLGLLRFAAS
VARGFFRIVCSLLLGGSLVEGAKKIKVAELLASMPDPTQDEVRGDADEAGRKPRESALPS
EDLADLKGLAGESDLLSDIFGLDLKREGGQYKLIPHNPNAGLGDLLGSPEPLPEPQEKPQ
EQKAKEEEKQEKEEPRAEPEKAEGGDGEKEDKANVKGRPRPRQLHTHRHGESEVPESAFW
KKITAYQQKLLNYFARNFYNMRMLALFVAFAINFILLFYKVSTSSVAEGKEPPAQSPSES
APVPSVDGDSRSVIAVHYVLEESSGYMEPTLRILAVLHTVIAFFCIIGYYCLKVPLVIFK
REKEVARKLEFGGLYVTEQPSEDDIKGQWDRLAINTQSFPNNYWDKFVKRKVMDKYGEFY
GRDRISELLGMDKAALDFSDAREKKKPKKDSSLAAVLNAIDVKYQMWKLGVVFTDNSFLY
LAWYMAMSVLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLY
TVVAFNFFRKFYNKSEDGDAPDMKCDDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEYEI
YRIIFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTV
PHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWEFFPAGDCFRKQ
YEDQLN
NT seq 14961 nt   +upstreamnt  +downstreamnt
atgcttttccacgtggagcagcatctcccctccaggcgaggcggctcgagacgtgagcat
gggctgcgtgacgacgaagtggttctgcagagcacggccgccacccacaaggagcagcag
aagctgtgcctggcagcggaaggcttcggcaacagactgtgcttcctggagccgacgtcc
aactccaagaatgtgcccccagacctgtccgtctgcaccttcgtgctggagcagtcgctg
tcggtgcgcgccctgcaggagatgctggcctgcacggtggagaagtcggaagggcaagtt
gacgtggaaaaatggaagttcatgatgaagacggctcaaggcggtggccaccggacgctg
ctctacgggcatgccatcctgctgcgccactcctacagcggcatgtatctgtgctgcctg
tccacctcccggtcttcaaccgacaagctggcttttgacgtgggcttgcaggaggacacc
acaggtgaggcgtgctggtggaccatacatcccgcctccaagcagagatccgagggggag
aaagtgcgagtgggggatgacctcatcctcgtcagcgtgtcctccgagaggtacttgcac
ctgtcctacggcgagggcagcctgcatgtggacgccgccttccagcagaccctctggagc
gtggctcccatcagctcagggagtgaagcagcccaagggtacctgatcggtggcgacgtc
ctcaggctgctgcacgggcacatggatgagtgcctcaccgtcccctccggagagcacacc
ggggagcagcgcagaactgtccactatgaaggcggagctgtgtcggcgcacgcgcgttcc
ctgtggagacttgagacgctccgagtcgcgtggagtggaagccacatccgatggggccag
cccttccggctgcggcatgtcaccacagggaagtacttgagcctcttggaagacaggaac
cttctgctggtggacaaggagaaagctgatgtgaagtcgacagcgttctccttccgctcg
tccaaggaaaagctggacgtgggggtgaggaaggaggtggacggcatgggggcgtccgag
atcaagtacggggactcggtgtgcttcatccagcacgtggactcgggcctgtggctcacc
taccaggccgtggacatgaagtcggccaggaggggctccgtgcagcggaaggctatcatg
caccacgagggccacatggacgacggcttaaacctgtcgcggtctcagcacgaggagtcc
cgcacggcccgagtcatccggagcacagtcttcctcttcaacaggttcatcaggnncctc
gataggcgcagcaggaaggccaaggcccccgtggacctgcccattgagtccatgagcctg
agcctgcaggatctgatcggctacttccacccccccgacgagcacctggaacacgaggac
aagcagaaccggctccgggccctgaagaaccggcagaacctcttccaggaggagggcatg
atcaacctggtgctggagtgtgtggaccggctgcacgtgtatagcagcgctgcccacttc
tcggatgtggccgggcgggaggccggggagtcgtggaagtccatcctcaactccctgtac
gagctgctggcggctctcatcagaggaaatcgtaaaaactgtgctcagttctccggttcc
ctcgactggctcatcagcaggctggagcggctggaggcatcctcaggtattctggaggtt
ttgcactgcgtgttagtggaaagcccggaggcgctgaatattattaaggaaggacacatt
aaatccatcatctcgctgttggacaagcacgggaggaatcacaaggtcctggatgtcctg
tgctctctgtgcgtgtgccatggggtcgctgtccgttccaaccagcacctcatctgtgag
aacctcctgccgggcagagacctgctgctgcagacacgtctggtgaaccacgtgagcagc
atgcggcccaacatcttcctgggcgtgagtgaagggtccgcgcagtacaggaagtggtac
tatgagctgacagtggaccacacagagcccttcgtgacggccgaggccactcacctgcgc
gtgggttgggcctccaccgaggggtcctccccctaccctggagggggtgaggagtggggt
ggaaacggcgtcggggatgacctcttctcctacgggttcgatggcctgcatctctggtcg
ggctgcgtggcccgcaccgtgagctctccaagccagcacctgctgagaacggaggacgtg
gtcagctgctgtctggacctcagtgccccgagcatctccttccggatcaacggccagcct
gtccaggggatgttcgagaacttcaacgtggacggcctcttcttccccgtcgtcagcttc
tctgcggggatcaaggtccgctttctgctcggggggcggcatggagagttcaaattcctg
cccccacccggctacgcgccttgttatgaagcagtcctgccgaaggagaagttgaaagtg
gagcacagccgcgagtacaagcaagagaggacctccatgcgggaactgctgggacctacc
gtctccctgacgcaggctggcttcacccccgcgcccgtggacaccagccagatcgtgttg
ccaccccacctggaaagggtacgggagaagctggcggagaacatccacgagctctgggtg
atgaataaaatcgaacttggctggcagtacggcccggtcagagatgacaacaagaggcag
cacccatgcctggtggagttctccaagctgcccgagcaggagcgcaactacaacctgcag
atgtcgctcgagaccctgaagacattgctggctctgggctgccacgtgggcctgtcagac
gagcacgctgaggagaaggtgaagaggatgaagctgcccaagaattaccagctgagcagt
gcgtacaagccggccccgatggacctgagctttgtcaaactcagcccgtcccaggaggcc
atggtggacaagctggccgagaacgcccacaacgtgtgggcacgggaccggatccggcag
ggttggacctatggcatccagcaggatgtgaagaacaggaggaaccctcgcctggtgccc
tacgccctcctggacgagcggaccaagaggtccaacaaggacagtctccgcgaggccgtg
cggaccctgctgggccacggctgccacctgcaggccccggaccaggaccccgccccccga
gccgaggtgagcagtggtacaggggagaggttccggatcttccgggccgagaagacctac
gcggtgaaggcgggccgctggtacttcgagttcgaggccgtcactgccggggacatgcgt
gtgggctggagcaggccgggctgccagccggaccgggagctgggctcggacgagcaggcc
ttcgcttttgacggcctcaaggctcagcggtggcaccagggcagtgaacactatgggcgc
ccgtggcaggcgggagacgtggtgggctgcatggtcgacatggatgagcacaccgcggtg
ttcacgctcaacggcgaggtcctgctcgacgactctggctctgagctggcgttcaaggac
ttcgacgtcagggacggcttcatacctgtgtgcagcctcggcgtgggccaggtgggcagg
atgaacttcgggaaggacgtcagcaccctcaagtacttcaccgtctgcggcttacaggag
ggctacgagcccttcgctgtcaacaccaacagggacgtcaccatgtggctgagcaagcgg
ctgcctcagttcctccaagtcccctcgaaccacgagcatattgaggtgaccaggatcgat
ggtactgtggacagctccccgtgtctgaaggtcacccagaagtcctttggctcccagaac
agcagccctgacatcatgttttatcgcctgagcatgcccatcgagtgtgccgaggtcttc
tccaagactgtggttggggggctgcctggcactgggctctttgggcccaagaacgacctg
gaggactatgacgcagactctgacttcgaggtcctaatgaagacggctcacggtcacctg
gcgtctgaccgtgcggacaaggacagagatgccgccaagctggaggtcaacaaccacaag
gactgtgcgcaggagaagccctctcgtctgaggcaaaggtttttgctcagaagaacgaag
ccagattacagcgcgagccactcggcgagactcactgaagacgtccttgctgacggccgg
gatgactacgactacctgatgcaggcgtccacgtattactactcagtgaggatcttcccc
gggcaggagcccgccaacgtctgggtgggctggatcacgtccgacttccaccagcatgac
accgtctttgacctggacagagttcgcacggtgacggtgactctgggggacgagaaagga
aaagtgcatgagagcatcaagcgcagcaactgctacatggtgtgtgcgggcgagggcctg
agccccggccaggggcgcaacagcggcgggctggagatcggctgcatggtggacgctgcc
agcgggctgctcaccttcatggccaacggcaaggagctgggcacctactaccaggtggaa
ccaagtacgaaattattccctgcggtgttcgcacaggctaccagccccaacgtgttccag
tttgagctggggaggataaagaacgtgatgccgctgtccgcggggctgttcaagagcgag
caccgcaaccccgtgccacagtgcccgccacgcctgcacgtccagtgcctgtcccacgtg
ctgtggagccgcatgcccaaccagttcctgaaggtggacgtcgcccgcgtcagtgagcgc
cagggctggctggtgcagtgtgcggacccgctgcagttcatgaccctgcacatccccgag
gagaacaggtctgtggacatcctggagctgacggagcaggaggagctgctgcgtttccac
taccacacgctgcggctgtactcggccgtgtgcgcgctggggaaccaccgggctgcccac
gccctgtgcagccacgtggacgggccgcagctgctctacgccatcgagagtaagcacatg
ccggggctgctgcgtgccggctactacgacctgctcatcgacatccacctgcgctcctac
gccacggcccggctcgccatggacggcgagttcatcgtgcccatgacgcccgacaccaag
agcatcaccctcttccccgacgcgcgcaagcggcacgggctcccgggcatcggcctgagc
acctcgctgcggccgcccatgcacttctccgcccccggctgcgtgagcgtcggccacgag
tgcttccagcacagccccgagttcccgctggacgtcctcaaggccaagaccatgcagatg
ctgacggaggccgtcagggagggcagcctgcatgcccgtgacccggtcggaggcaccacc
gagttcctgttcgtgcccctcatcaagctcttctacaccctgctcatcatgggcgtcttc
cacggcgaagacctgcggcatgtcctacggctcatcgagccccgtgtgttcaaggacgct
gccgaccccagccctgaggacgaggacgaagacggggcccacacgccggtggaggagcct
ggcgccgacacctcgaagcccgaaggagctggtgaagatgagggcagaggcgctccgcgg
ccgcaggagggcctgctccagatgaagctgccagagccggtgaagctgcagatgtgcctc
ctgctccagcacctctgtgactgccaggtgcggcaccgcatcgaagccatcgtggccttc
tcggacggcttcgtggccaagctccaggacaaccaacgcttccgctacaacgaggtcatg
caggccttgaacatgtcggccgccctcacggctcgcaagaccaaagagttccggtcacca
ccgcaggagcagatcaatatgcttctcaacttcaaggatgacaaaagtgaatgtccatgc
cctgaggaaatccgggaccaactcctggatttccatgaagacttgatggcgcactgtgga
atcgagctggatgaagacgggtctctggacgggagcagtgactccaccattcgaggacgc
ctgctgtccctggtggagaaggtgacgtacctgaagaagaagcaggcggagaagccagtg
gagcgcaacgccaagaaaccctccagcctgcagcagctgatctctgagaccatggtgcgg
tgggctcaggaggccgtcatcgaagacccggagctggtgagggccatgtttgtgctcctg
caccggcagtatgatggcatcggggggctggttcgggctctgccgaagacctacacgatc
aacagcgtctctgtggaggacaccgtcagcctgctggcgtccctcgggcagatccgctct
ctgctgagcgtgaggatgggccgggaagaagagaagctgatgatccgtggcctgggggac
atcatgaacaacaaggtgttttaccagcacccgaacctcatgcgggcactcggcatgcac
gagacggtgatggaggtcatggtcaacgtgctggggggcggcgagtccaaggaaatcgcc
ttccctaagatggtggccaactgctgccggttcctctgctacttctgccggatcagcagg
cagaaccagaaggccatgttcgaccacctcagctacttgctggagaacagcagcgttggc
ctcgcctccccggccatgagagggtcgacgcccctggacgtggccgcggcctcggtgatg
gacaacaatgagctggccctggcgctgcgcgagccggatctggagaaggtggtccggtac
ctggccggctgcgggctgcagagctgccagctgctggtgtccaggggctacccagatgtt
ggctggaaccccgtggaaggggagcgctacctcgacttcctcagatttgctgtcttctgc
aatggggagagcgtggaggagaacgccaacgtggtggtacggctgctcatccgcaggccc
gagtgcttcggccccgccctgaggggcgaggggggccatggtctgctcgccgccatggaa
gaggccataaagattgcagaggacccctcccgagacggcccctcgccagccagcgggtcc
agcaggacgcttgacacggaagagggggaggatgacaccatccacatggggaacgccatc
atgaccttctacgcagcgctgatcgacctcctcggccgctgtgcccctgagatgcacctg
atccacgctgggaagggagaggccatcagaatcaggtccattttgagatccctgatccca
ctgggagatctagtgggcgtcatcagcatcgctttccagatgccgacgctggccagagat
gggagcgtggcagaacctgacatgtccgcggggttttgcccagaccacaaggcagccatg
gttttgttccttgacagggtctatgggattgaggtccaagatttcctcctccacctcctt
gaggttggctttctgccagatctccgggcggctgcatccttagacacggctgctctgagc
gccacagacatggccctggccctcaaccgctacctctgcacggccgtgctgcccctgctg
acgcggtgtgcccccctctttgctggcacggagcgccacgcctcgctcatcgactcgctg
ctgcacacagtgtaccggctgtccaagggctgttcgctcaccaaggcccagcgggacgcc
atcgaggtctgcctgctgtccatctgcagccagctgcggccgtccacgatgcagcatctg
ctccggaggctggtgtttgatgtcccgctgctgaatgagcacgccaagatgcccctcaag
ctgctgaccaaccactacgaacgctgctggaagtactactgcctgtcccgggggtggggc
agcttcggcgctgcctcagaggaggagctccacctgtcccggaagctgttctggggcatc
ttcgatgccctgtcccagaagaaatatgagcaagagcttttcaagctggcccttccttgc
ctgagcgcggtggctggggctctgccccctgactacatggagtcgagctacgtgaacaca
ctggagaagcagtcttccgtggatgccgaggggaacttcaacccgcagccggtcgacacc
tctaacatcaccatcccggagaagctggagtgcttcatcaacaagtacgccgagcacacg
catgacaagtggtcggtggacaagctggcaaacggatgggtttacggagaggtgtactcg
gactcgtccaaggtccagcccttgatgaagccatacaagctactctccgaaaaggaaaaa
gaaatttatcgctggccaatcaaggaatctttaaagaccatgctggcatggggctggagg
atcgagaggacgcgggagggggacagcatggccctgtataaccgggctcgccgcatttct
cagactagccaggtttccatggacgccgcccatggctacagcccgcgggccctcgacatg
agcaacgtgacgctgtccagagacctgcacgctatggcagagatgatggctgagaactac
cacaacatatgggcgaagaagaagaagctggagctggagtccaaaggagggggcagccac
cccctgctggtgccctatgacacgctgaccgccaaggagaaagccagggatcgggagaag
gctcaggacatcctcaagtttctgcagatcaacggatacgccgtgtcccgagggttccag
gacctggagctggacacgccctcggtggagaagcgcttcgcctacagcctcctgcagcag
ctggtgcactgtgtggacgcggcccaccagcacatcctggagttcgatggcggcggcagg
ggccaaggagggcatttcccccacgagcaggaggtcaagttcttcgccaaggtcgttctt
ccgctgattgatcagtatttcaagaaccaccgcctgtacttcctgtccgctgcgagccgc
cccctctgctccgggggacacgcatccaataaggagaaggagatggtgaccagcctgttc
tgcaaacttggagttcttgtcaggcataggatctcgctgtttggaaacgatgccacgtct
attgtcaactgcctccatattctggctcagactttggacgcaaggaccgtgatgaagacg
ggcctggagagcgtgaagagtgcgctgcgggcgttcctggacagcgcggccgaggacctg
gagcagaccctggagaacctgcagcagggccagttcacgcacacgcggagccagcccaag
ggcgtcacgcagatcatcaactacaccacggtggccctgctgcccgtgctgtcctcgctg
ttcgagcacgtcggccagcaccagttcggggaagacctgatcctggaagacgtgcaggtg
tcctgctacaggatcctgagcagcctgtatgccttggggaccagcaggagcatttacgtg
gagaggcagcgctctgccctgggggagtgcctggcggccttcgcgggtgccttccccgtg
gcattcctagagacgcacctgaacaagcacaatgcctactccatctacaacaccaggtct
tcccgcgagagggcagccctcagcctgccccccagcgtggaggacgtgtgcccgaacatc
ccgtcgctggacaagctgatggccgacatcgtggagctggccgaggcgggcacgcgctac
ccgcaggcaccgcatgtggtggaggtggtgctgcccatgctgtgtgcctacacgtcgcgc
tggtgggagcgcgggcccgagggcggcacgcagggccccgaggcctgctgcaccgccttg
cgcgccgagcacatggacacgctgctgggcagcatcctcaagatcatctaccacaacctg
ggtgtcgacgagggcgcctggatgaagcggctggcagtgttctcccagcccatcataaac
aaggtgaagcctcagctcctgaaaacccacttcttacctctgatggagaagctcaagaac
aaggcggccatggtggtggcggacgaggaccagctgaaggcggaggcccggggggacatg
tcggaggctgagctgctcatcctggacgacttcactacgttggcacgggacctgtatgcc
ttctaccctctcctgatccgattcgtggactataacagggcgaagtggctcaaggagcct
aacccagaggctgaggagctcttccgcatggtggctgaggtgttcatctactggtccaag
tcccacaatttcaaaagagaagagcagaacttcgttgtacagaatgagatcaacaatatg
tcgttcctcatcacagacaccaagtcaaagatgtcgaaggccgctgtgtctgaccaggag
cggaagaagatgaagcgcaagggggaccgctactccctgcagacctcgctggtcgtggcc
gccctgaagcgcctgctgcccgtcggcctcaacatctgcgccccgggcgaccaggagctc
atcgctctggccaaaagccggtttagcctgaaggacaccgaggacgaggtgcgagacgtg
atccgcagcaacatccacacacaaggcaagctggaggaccccgctattcggtggcagatg
gtgctttataaggacttaccaaacaggacggaggacacctctgatccggagaagacagtg
gacagagtgctggacatggcgaacgtgctcttccacctcgagcagaactctaaaactgtg
gcccgtggatgtcacagcctggtggagcacccgcagaggtccaagaaggccgtctggcac
aagctgctctccaagcagaggaagagggcggtggtggcctgcttccgcatggccccgctg
tacaacctgcccaggcaccgggccgtcaacctctttcttcagggatacgagaagtcttgg
attgaagcggaagagcactactttgaggataaactgatagaagatttagcaaagcccggg
gctgaccttccggaagaagacgaaggcgctaagagagttgaccccctgcaccagctgatc
cttctgttcagccggacagcgctgacggagaaatgcaaactggaggaagactttctgtac
atggcatacgcgggtatcatggcgaagagctgtcatgacgaggaggacgaagacggcgaa
gaggaagtgaagagctttgaagtcacgggatcccaacgcagcaaggagaaagagatggag
aagcagaagcttctgtaccagcaggccaggctgcacgaccgcggggccgccgagatggtg
ctgcagaccctgagcgccagcaaaggtgacagtgggccgatggtcgccgccacgctgaaa
ctcgggatcgctgttctgaatggggggaactccacggtgcagcagaaaatgctcgactac
ctgaaggaaaagaaggacgtggggttcttccagagcctggccggcctcatgcagtcctgc
agtgtccttgacctcaacgccttcgagcggcacaacaaggccgagggactggggatggtg
acggaggaggggtcaggggacaaggttctgcaggatgacgagttcacctgtgacctcttc
cggttcctgcagctgctctgtgaggggcacaactcagattttcagaactacctgaggact
caaaccggcaacaacacgactgtcaacatcatcatctctacggtggactacctgctgcgg
gtccaggagtccatcagtgacttctactggtactactcggggaaggacgtcatcgacgag
caggggcagcgcaatttctccaaagctatccaggtggctaagcaggtcttcaacacgctc
acggagtacatccagggcccgtgcacggggaaccagcagagcctggcgcacagcaggctc
tgggacgcggtggtgggcttcctccacgtgttcgcccacatgcagatgaagctgtcgcag
gactccagtcagatcgagctgctgaaggagctgatggacctgcagaaggacatggtggtc
acgctgctgtccatgctggaaggtaacgttgtcaacggcacgatcggcaagcagatggtg
gacatgctggtggagtcctcccacaacgtggagatgatcctcaagttcttcgacatgttc
ctgaaactgaaggacctgacgtcctccgacaccttcaaggagtgcgaccctgatggcaag
ggcgtcatctccaagagggacttccacagggcaatggagggccacaagcactacacgccg
tccgagaccgagttcctgctctcctgtgccgagaccgatgagaacgagaccctggactac
gaggagttcgtcaagcgcttccatgagcccgccaaggacatcggcttcaacgtggcggtg
ctgctgaccaacctgtcggagcacatgccccacgacccgcggctgcacaccttcctggcg
ctggcggagagtgcgctgcactacttccagcccttcctgggccgcatcgagatcatgggc
agcgccaagcgcatcgagcgggtgtacttcgagatcagcgagtccagccgcacccagtgg
gagaagccgcaggtcaaggagtccaagcggcagttcatctttgacgtggtcaacgagggt
ggggagaaggagaagatggagctgtttgtgaacttctgtgaggacaccatcttcgagatg
cagctggccgcccagatctccgagtcggacctgaacgagcggtcggcgagcaaggaggac
agcgagagggaccggcctgaggagcagggcccgaggcccggcttcttctcggtgctgatg
ctccggtcagccctgctggccctccggtacaacctcctggttctgctgcgcctgctcagc
ctgaagagcctgaagaagcaggtgaagcgggccaagaggatgacggtgcgggacctgctg
gccgccctgctggcgtcctgctggcgcctgctgctgggcttgctgcgctttgcagccagc
gtggcccgcggcttcttccgcatcgtgtgctccctgctgctggggggcagcctggtggag
ggcgccaagaagatcaaggtggccgagctcctggccagcatgccggaccccacgcaggac
gaggtgcgcggggacgcggacgaggcggggaggaagccccgcgagagcgccctgccgtcc
gaggacctggccgacctgaaggggctggcgggggagagcgacctgctctccgacatattc
ggcctggacctgaagagggagggcggccagtacaagctcatcccgcacaaccccaacgcc
ggcctcggcgacctcctgggcagcccggagcccctgcctgagccgcaggagaagccgcag
gaacagaaggcaaaagaggaagagaagcaggagaaggaggagcccagagctgagcccgag
aaagccgagggcggagatggagagaaggaggacaaggccaatgtcaagggcaggccgcgg
cccaggcagctgcacacgcacagacatggggagtcggaagtcccggagtcggcgttctgg
aagaaaatcaccgcgtatcagcagaagcttctcaactattttgctcgcaacttttacaac
atgcgaatgctagccttgttcgtcgccttcgcgatcaacttcatcttgctcttttataag
gtctccacatcctctgtggccgaagggaaggagcctcctgctcaaagcccaagcgagagt
gccccagtccctagcgtggatggcgactcacgcagtgttatcgcggtccactatgtcctg
gaggagagcagcggctacatggagcccacgctgcgcatcctggccgtgctccacacggtc
atcgccttcttctgcatcatcggctactactgcctcaaggtgccgctggtcattttcaag
cgcgagaaggaggtggcacggaagctggagttcggcgggctgtacgtcaccgagcagcca
tcggaggatgacatcaagggccagtgggacagactcgccatcaacacgcagtcatttcct
aacaactactgggacaaatttgttaaaagaaaggtgatggacaagtacggggagttttac
ggccgcgacaggatcagcgagctgctgggcatggacaaggcggccctggacttcagtgat
gcccgagagaagaagaagcccaagaaggacagctccctggcggctgtcctgaacgccatc
gacgtcaagtaccagatgtggaaactcggcgtggtcttcactgacaactccttcctctac
ctggcctggtacatggccatgtccgtcctcgggcactacaacaacttcttcttcgccgcg
caccttctcgacatcgccatggggttcaagacgctgaggaccatcttgtcatctgtgacc
cacaacggtaaacagctcgtcctcaccgtgggcctcctggccgtcgtcgtgtacctctac
accgtggtcgcgttcaacttcttccggaaattctacaacaaaagcgaagacggagacgcg
ccggacatgaagtgtgacgacatgctgacgtgctacatgttccacatgtatgtgggcgtg
cgggccggagggggcatcggcgatgagatcgaggacccggcaggggacgagtacgagatc
tacaggatcatcttcgacatcaccttcttcttcttcgtcatcgtcatcctcctggccatc
atacaaggtctgattattgacgcctttggagagctgcgggaccagcaggagcaggtcaag
gaggacatggagaccaagtgcttcatctgcggcataggcaacgactacttcgacacggtg
ccacacggtttcgagacccacaccctgcaggagcacaacctggccaattacctgtttttc
ctgatgtacctgataaacaaggatgagacagagcacacgggacaggagtcctacgtctgg
aagatgtaccaggagaggtgctgggagttcttccctgcgggggactgcttccggaagcag
tacgaagaccagctcaactaa

DBGET integrated database retrieval system