KEGG   Tupaia chinensis (Chinese tree shrew): 102473848
Entry
102473848         CDS       T02978                                 

Gene name
CCK
Definition
(RefSeq) cholecystokinin
  KO
K05226  cholecystokinin
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04080  Neuroactive ligand-receptor interaction
tup04911  Insulin secretion
tup04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102473848 (CCK)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102473848 (CCK)
  09154 Digestive system
   04972 Pancreatic secretion
    102473848 (CCK)
SSDB
Motif
Pfam: Gastrin
Other DBs
NCBI-GeneID: 102473848
NCBI-ProteinID: XP_006155455
LinkDB
Position
Un
AA seq 115 aa
MNSGVCLCVLMTTLAVGALSQPVPPVDPAGTGMQPAEEAPRRQLMAGQRPDSEPRAHLGA
LLARYIQQARKAPSGRMSIMKNLQSLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
NT seq 348 nt   +upstreamnt  +downstreamnt
atgaacagcggcgtgtgcctgtgtgtgctgatgacgacgctggcggtgggtgctctgtcg
cagccggtgcccccagtagaccccgcgggcaccgggatgcagccggctgaagaggccccg
cggaggcagctcatggcggggcagaggcctgacagcgagccccgagcgcacctgggcgcg
ctgctggccaggtacatccagcaggccaggaaagctccttccggtagaatgtccatcatg
aagaacctgcagagcctggaccccagccacaggataagtgatcgggactacatgggctgg
atggattttggccgacgcagtgccgaggagtatgagtacccctcctaa

DBGET integrated database retrieval system