KEGG   Tupaia chinensis (Chinese tree shrew): 102474011
Entry
102474011         CDS       T02978                                 

Gene name
CTRL
Definition
(RefSeq) chymotrypsin like
  KO
K09632  chymotrypsin-like protease [EC:3.4.21.-]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04972  Pancreatic secretion
tup04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    102474011 (CTRL)
   04974 Protein digestion and absorption
    102474011 (CTRL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tup01002]
    102474011 (CTRL)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     102474011 (CTRL)
Peptidases and inhibitors [BR:tup01002]
 Serine peptidases
  Family S1: chymotrypsin family
   102474011 (CTRL)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986 DUF316 Peptidase_C37 Pico_P2A
Other DBs
NCBI-GeneID: 102474011
NCBI-ProteinID: XP_006156943
LinkDB
Position
Un
AA seq 264 aa
MLLLSLTLSLVLLGSSWGCGVPAIKPALSFSQRIVNGENAVSGSWPWQVSLQDSTGFHFC
GGSLISPYWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPVQVLSISRAITHPNWNAATMNN
DLTLLKLASPAQYTARVSPVCLASSNEVLPTGLTCVTTGWGRLSGVGNVTPARLQQVVLP
LVTVNQCQQYWGSRITDSMICAGGSGASSCQGDSGGPLVCQKGNTWVLIGVVSWGTSDCN
VRAPAMYTRVSKFNAWINQVIAYN
NT seq 795 nt   +upstreamnt  +downstreamnt
atgctgctgcttagcctgactctcagtctggtcctccttgggtcttcctggggctgcggt
gtccctgccatcaaaccggcactgagcttcagccagaggattgtcaacggggagaatgca
gtgtcgggctcctggccctggcaggtgtccctgcaggacagcactggcttccacttttgt
ggcggttctctcatcagcccgtactgggtagtcactgctgcccactgcaatgtcagccct
ggtcgccactttgttgtcctgggtgagtacgaccgatcctccaatgctgagcctgtgcag
gtcctgtccatctcacgggccatcacgcaccctaactggaatgctgccaccatgaacaac
gacctgactctactgaagcttgcctcgccagcccagtacacagcacgtgtctctccagtt
tgcctggcttcctcaaacgaagtgctgcccacaggcctcacctgtgtcaccaccggctgg
ggccgcctcagtggcgtgggcaacgtgacaccagcgcgtctgcagcaagtagttctgccg
ctggtcactgtgaatcagtgccagcagtattggggctcacgtatcactgactccatgatc
tgcgcaggtggctcaggtgcctcctcatgccagggtgactctggaggccctcttgtctgc
cagaagggaaacacatgggtgctcattggtgttgtctcctggggcactagtgactgcaat
gtgcgtgcacctgccatgtacacacgggttagcaaattcaatgcctggatcaaccaggtc
atagcctataactga

DBGET integrated database retrieval system