KEGG   Tupaia chinensis (Chinese tree shrew): 102474592
Entry
102474592         CDS       T02978                                 

Gene name
BCL2
Definition
(RefSeq) BCL2, apoptosis regulator
  KO
K02161  apoptosis regulator Bcl-2
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01521  EGFR tyrosine kinase inhibitor resistance
tup01522  Endocrine resistance
tup01524  Platinum drug resistance
tup04064  NF-kappa B signaling pathway
tup04066  HIF-1 signaling pathway
tup04071  Sphingolipid signaling pathway
tup04115  p53 signaling pathway
tup04140  Autophagy - animal
tup04141  Protein processing in endoplasmic reticulum
tup04151  PI3K-Akt signaling pathway
tup04210  Apoptosis
tup04215  Apoptosis - multiple species
tup04217  Necroptosis
tup04261  Adrenergic signaling in cardiomyocytes
tup04340  Hedgehog signaling pathway
tup04510  Focal adhesion
tup04621  NOD-like receptor signaling pathway
tup04630  JAK-STAT signaling pathway
tup04722  Neurotrophin signaling pathway
tup04725  Cholinergic synapse
tup04915  Estrogen signaling pathway
tup04928  Parathyroid hormone synthesis, secretion and action
tup04933  AGE-RAGE signaling pathway in diabetic complications
tup05014  Amyotrophic lateral sclerosis
tup05022  Pathways of neurodegeneration - multiple diseases
tup05132  Salmonella infection
tup05145  Toxoplasmosis
tup05152  Tuberculosis
tup05161  Hepatitis B
tup05162  Measles
tup05168  Herpes simplex virus 1 infection
tup05169  Epstein-Barr virus infection
tup05170  Human immunodeficiency virus 1 infection
tup05200  Pathways in cancer
tup05206  MicroRNAs in cancer
tup05210  Colorectal cancer
tup05215  Prostate cancer
tup05222  Small cell lung cancer
tup05226  Gastric cancer
tup05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tup00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102474592 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102474592 (BCL2)
   04630 JAK-STAT signaling pathway
    102474592 (BCL2)
   04064 NF-kappa B signaling pathway
    102474592 (BCL2)
   04066 HIF-1 signaling pathway
    102474592 (BCL2)
   04071 Sphingolipid signaling pathway
    102474592 (BCL2)
   04151 PI3K-Akt signaling pathway
    102474592 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102474592 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    102474592 (BCL2)
   04215 Apoptosis - multiple species
    102474592 (BCL2)
   04217 Necroptosis
    102474592 (BCL2)
   04115 p53 signaling pathway
    102474592 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102474592 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102474592 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    102474592 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    102474592 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102474592 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    102474592 (BCL2)
   04722 Neurotrophin signaling pathway
    102474592 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102474592 (BCL2)
   05206 MicroRNAs in cancer
    102474592 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102474592 (BCL2)
   05226 Gastric cancer
    102474592 (BCL2)
   05215 Prostate cancer
    102474592 (BCL2)
   05222 Small cell lung cancer
    102474592 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102474592 (BCL2)
   05022 Pathways of neurodegeneration - multiple diseases
    102474592 (BCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102474592 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102474592 (BCL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102474592 (BCL2)
   05152 Tuberculosis
    102474592 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102474592 (BCL2)
   05161 Hepatitis B
    102474592 (BCL2)
   05162 Measles
    102474592 (BCL2)
   05168 Herpes simplex virus 1 infection
    102474592 (BCL2)
   05169 Epstein-Barr virus infection
    102474592 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102474592 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102474592 (BCL2)
   01524 Platinum drug resistance
    102474592 (BCL2)
   01522 Endocrine resistance
    102474592 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tup01009]
    102474592 (BCL2)
Protein phosphatases and associated proteins [BR:tup01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102474592 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 102474592
NCBI-ProteinID: XP_006141898
LinkDB
Position
Un
AA seq 238 aa
MAHAGRTGYDNREIVMKYIHYKLAQRGYEWDAGDAGAASPGAAPAPGIFSSQPGRTPPPA
TPGDPAARTSPSPPPMAAAVAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHL
TPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYL
NRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
NT seq 717 nt   +upstreamnt  +downstreamnt
atggcgcacgccgggagaacagggtatgataaccgggagatagtgatgaagtacatccac
tataagctggcgcagaggggctacgaatgggacgcgggggacgcgggcgctgcgtccccg
ggggccgcccccgcgccgggcatcttctcctcccaacccgggcgcacgcccccgcccgcc
acgcctggggacccggcagccaggacctcgccgtcgccgcccccgatggccgccgccgtc
gcggggcctgcgctcagcccggtgccacctgtggtccacctgaccctccgccaggccggc
gatgacttctcccggcgctaccgccgcgacttcgccgagatgtccagccagctgcacctg
acgcccttcaccgcgaggggacgctttgccacggtggtggaggagctcttcagggatggg
gtgaactgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggagagc
gtcaaccgggagatgtcgcccctggtggacaacatcgccctgtggatgactgagtacctg
aaccggcacctgcacacctggatccaggataacggaggctgggatgctttcgtggaacta
tatggccccagcatgcggcctctgtttgatttctcctggctgtctctgaagacgctgctc
agtcttgccctggtgggagcctgcatcaccctgggtgcctacctgggccacaagtga

DBGET integrated database retrieval system