KEGG   Tupaia chinensis (Chinese tree shrew): 102475423
Entry
102475423         CDS       T02978                                 

Gene name
RPS6KB2
Definition
(RefSeq) ribosomal protein S6 kinase B2
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01521  EGFR tyrosine kinase inhibitor resistance
tup01522  Endocrine resistance
tup04012  ErbB signaling pathway
tup04066  HIF-1 signaling pathway
tup04140  Autophagy - animal
tup04150  mTOR signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04152  AMPK signaling pathway
tup04211  Longevity regulating pathway
tup04213  Longevity regulating pathway - multiple species
tup04350  TGF-beta signaling pathway
tup04371  Apelin signaling pathway
tup04666  Fc gamma R-mediated phagocytosis
tup04714  Thermogenesis
tup04910  Insulin signaling pathway
tup04931  Insulin resistance
tup05163  Human cytomegalovirus infection
tup05165  Human papillomavirus infection
tup05170  Human immunodeficiency virus 1 infection
tup05200  Pathways in cancer
tup05205  Proteoglycans in cancer
tup05210  Colorectal cancer
tup05212  Pancreatic cancer
tup05221  Acute myeloid leukemia
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
tup05231  Choline metabolism in cancer
tup05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102475423 (RPS6KB2)
   04350 TGF-beta signaling pathway
    102475423 (RPS6KB2)
   04371 Apelin signaling pathway
    102475423 (RPS6KB2)
   04066 HIF-1 signaling pathway
    102475423 (RPS6KB2)
   04151 PI3K-Akt signaling pathway
    102475423 (RPS6KB2)
   04152 AMPK signaling pathway
    102475423 (RPS6KB2)
   04150 mTOR signaling pathway
    102475423 (RPS6KB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102475423 (RPS6KB2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    102475423 (RPS6KB2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102475423 (RPS6KB2)
  09149 Aging
   04211 Longevity regulating pathway
    102475423 (RPS6KB2)
   04213 Longevity regulating pathway - multiple species
    102475423 (RPS6KB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    102475423 (RPS6KB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102475423 (RPS6KB2)
   05205 Proteoglycans in cancer
    102475423 (RPS6KB2)
   05231 Choline metabolism in cancer
    102475423 (RPS6KB2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102475423 (RPS6KB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102475423 (RPS6KB2)
   05212 Pancreatic cancer
    102475423 (RPS6KB2)
   05225 Hepatocellular carcinoma
    102475423 (RPS6KB2)
   05226 Gastric cancer
    102475423 (RPS6KB2)
   05221 Acute myeloid leukemia
    102475423 (RPS6KB2)
   05224 Breast cancer
    102475423 (RPS6KB2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102475423 (RPS6KB2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102475423 (RPS6KB2)
   05163 Human cytomegalovirus infection
    102475423 (RPS6KB2)
   05165 Human papillomavirus infection
    102475423 (RPS6KB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102475423 (RPS6KB2)
   01522 Endocrine resistance
    102475423 (RPS6KB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tup01001]
    102475423 (RPS6KB2)
Enzymes [BR:tup01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102475423 (RPS6KB2)
Protein kinases [BR:tup01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   102475423 (RPS6KB2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 102475423
NCBI-ProteinID: XP_006171348
LinkDB
Position
Un
AA seq 388 aa
MKVLRKAKIVRNAKDTAHTRAERNILESVKHPFIVELAYAFQTGGKLYLILECLSGGELF
THLEREGIFLEDTACFYLAEITLALGHLHSQGIIYRDLKPENIMLNSQGHIKLTDFGLCK
ESIHEGAVTHTFCGTIEYMAPEILVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKT
MDKIIKGKLVLPPYLTPDARDLVKKFLKRNPSQRIGGGPADAADVQRHPFFRHINWDDLL
ARRIDPPFRPSLQSEEDVSQFDTRFTRQTPVDSPDDTSLSESANQAFLGFTYVAPSVLDS
IKEGFSFQPKVRSPRRLNSSPRTPISPLKFSPFEGFRPSPGPPEPMEPPLPPLLPPPTPP
PPSSTAPLPIRPPSGTKKSKRGRGRPGR
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgaaagtcctgaggaaggccaaaatcgtgcgcaatgccaaggacacagcacacacgcgg
gctgagcggaatattctagagtcagtgaaacaccccttcattgtggaactggcctatgcc
ttccagactggtggcaaactctacctcatcctcgagtgcctcagtggtggtgagctcttc
acacatctggagcgagaaggcatcttcctggaagacacggcctgcttctacctagctgag
atcacactggccctgggccatctccactcccaaggcatcatctaccgagacctcaaacct
gagaacatcatgctcaacagccagggccacatcaaactgacagacttcgggctctgcaag
gagtccatccacgagggtgctgtcactcacaccttctgcggcaccattgagtacatggct
cctgagattctggtgcgcagtggccacaaccgggcggtggactggtggagtttgggggcc
ctgatgtacgacatgctcactggatcgccaccctttactgcagagaaccggaagaaaacc
atggataagattatcaagggaaagctggtgctgcccccctacctcacgccagatgcccgg
gatctagtcaaaaagtttctgaagcggaatcccagccaacggattgggggtggccctgca
gatgctgctgatgtgcagaggcaccctttcttccggcatatcaattgggatgacctcctg
gcccgccgcatagacccccctttcaggccctctctgcagtccgaggaggacgtgagccag
tttgacacacgcttcacgcggcagacaccagtggacagtccagatgacacatccctcagc
gagagtgccaatcaggccttcctgggcttcacatacgtggcgccctccgtcctggacagc
ataaaggagggcttctccttccaacccaaggtgcgctccccccgacgcctcaacagcagt
ccccggacccccatcagccccctcaagttctcccccttcgaggggttccggcccagccct
ggcccaccagagcccatggagccacctctccctccactcctgccaccaccgacgccgcca
ccaccttcaagcactgcccccctccccatccgtcctccctcagggaccaagaagtccaag
aggggccgtgggcgccctgggcgctag

KEGG   Tupaia chinensis (Chinese tree shrew): 102493152
Entry
102493152         CDS       T02978                                 

Gene name
RPS6KB1
Definition
(RefSeq) ribosomal protein S6 kinase B1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01521  EGFR tyrosine kinase inhibitor resistance
tup01522  Endocrine resistance
tup04012  ErbB signaling pathway
tup04066  HIF-1 signaling pathway
tup04140  Autophagy - animal
tup04150  mTOR signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04152  AMPK signaling pathway
tup04211  Longevity regulating pathway
tup04213  Longevity regulating pathway - multiple species
tup04350  TGF-beta signaling pathway
tup04371  Apelin signaling pathway
tup04666  Fc gamma R-mediated phagocytosis
tup04714  Thermogenesis
tup04910  Insulin signaling pathway
tup04931  Insulin resistance
tup05163  Human cytomegalovirus infection
tup05165  Human papillomavirus infection
tup05170  Human immunodeficiency virus 1 infection
tup05200  Pathways in cancer
tup05205  Proteoglycans in cancer
tup05210  Colorectal cancer
tup05212  Pancreatic cancer
tup05221  Acute myeloid leukemia
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
tup05231  Choline metabolism in cancer
tup05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102493152 (RPS6KB1)
   04350 TGF-beta signaling pathway
    102493152 (RPS6KB1)
   04371 Apelin signaling pathway
    102493152 (RPS6KB1)
   04066 HIF-1 signaling pathway
    102493152 (RPS6KB1)
   04151 PI3K-Akt signaling pathway
    102493152 (RPS6KB1)
   04152 AMPK signaling pathway
    102493152 (RPS6KB1)
   04150 mTOR signaling pathway
    102493152 (RPS6KB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102493152 (RPS6KB1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    102493152 (RPS6KB1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102493152 (RPS6KB1)
  09149 Aging
   04211 Longevity regulating pathway
    102493152 (RPS6KB1)
   04213 Longevity regulating pathway - multiple species
    102493152 (RPS6KB1)
  09159 Environmental adaptation
   04714 Thermogenesis
    102493152 (RPS6KB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102493152 (RPS6KB1)
   05205 Proteoglycans in cancer
    102493152 (RPS6KB1)
   05231 Choline metabolism in cancer
    102493152 (RPS6KB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102493152 (RPS6KB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102493152 (RPS6KB1)
   05212 Pancreatic cancer
    102493152 (RPS6KB1)
   05225 Hepatocellular carcinoma
    102493152 (RPS6KB1)
   05226 Gastric cancer
    102493152 (RPS6KB1)
   05221 Acute myeloid leukemia
    102493152 (RPS6KB1)
   05224 Breast cancer
    102493152 (RPS6KB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    102493152 (RPS6KB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102493152 (RPS6KB1)
   05163 Human cytomegalovirus infection
    102493152 (RPS6KB1)
   05165 Human papillomavirus infection
    102493152 (RPS6KB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102493152 (RPS6KB1)
   01522 Endocrine resistance
    102493152 (RPS6KB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tup01001]
    102493152 (RPS6KB1)
Enzymes [BR:tup01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102493152 (RPS6KB1)
Protein kinases [BR:tup01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   102493152 (RPS6KB1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 102493152
NCBI-ProteinID: XP_006154663
LinkDB
Position
Un
AA seq 525 aa
MRRRRRRDGLYSAPDFQDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
IEQMDVTTSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgaggcgacgacggaggcgggacggcctttactcagcgccggacttccaagacagggaa
gctgaggacatggcaggagtgtttgacatagacttggatcagccagaggacgcgggctct
gaggatgagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagttgga
ccatatgaacttggcatggaacattgtgagaaatttgaaatttcagaaactagtgtgaac
agagggccagaaaaaatcagaccagaatgttttgagctacttcgggtgcttggtaaaggg
ggctatggaaaggtttttcaagtacgaaaagtaacaggagcaaatactgggaaaatattt
gccatgaaggtgcttaaaaaggcaatgatagtaagaaatgctaaagatacagctcataca
aaagcagaacggaatattctggaggaagtaaagcatcccttcattgtggatttaatttat
gcctttcagaccggtggaaaactctacctcatccttgagtatctcagtggaggagaatta
tttatgcagttagaaagagagggaatatttatggaagacacagcctgcttttacttggca
gaaatttccatggctttggggcatttacatcaaaaggggatcatctacagagacctgaag
ccggagaatatcatgcttaatcaccaaggtcatgtgaaactaaccgactttggactatgc
aaagaatctattcatgatggaacagtcacacacacattttgtggaacaatagaatacatg
gcccctgaaatcttgatgagaagtggtcacaatcgtgctgtggattggtggagtttggga
gcattaatgtatgacatgctgactggagcacccccatttactggtgagaatagaaagaaa
acaattgacaaaatcctcaaatgtaaactcaatttgcctccctacctcacacaagaagcc
agagatctgcttaaaaagctgctgaaaagaaacgctgcatctcgtcttggagctggtcct
ggggatgctggagaagttcaagctcatccattcttcagacacattaactgggaagaactt
ctagctcggaaagtggagcccccctttaagcctctgttgcaatctgaagaggatgtgagt
cagtttgattcaaagtttacacgtcagacacctgtcgacagcccagatgactcaactctc
agtgaaagtgccaaccaggtctttctgggttttacttatgtggctccatctgtacttgaa
agcgtgaaagaaaagttttcctttgaaccaaaaatccgatcacctcgaagatttattggc
agtccacgaacacctgtcagcccagtcaaattttctcctggggatttctggggaagaggt
gcttcagccagcacggcaaatcctcagacacctgtagaatacccaatggaaacaagtgga
atagagcagatggatgtgacgacaagtggggaagcgtcagcgccacttccaattcgacag
ccgaactccgggccatacaaaaaacaagcttttcccatgatctccaaacggccagagcac
ctgcgaatgaatctatga

DBGET integrated database retrieval system