KEGG   Tupaia chinensis (Chinese tree shrew): 102475580
Entry
102475580         CDS       T02978                                 

Gene name
GLI3
Definition
(RefSeq) GLI family zinc finger 3
  KO
K06230  zinc finger protein GLI3
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04024  cAMP signaling pathway
tup04340  Hedgehog signaling pathway
tup05200  Pathways in cancer
tup05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102475580 (GLI3)
   04024 cAMP signaling pathway
    102475580 (GLI3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102475580 (GLI3)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    102475580 (GLI3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tup03000]
    102475580 (GLI3)
Transcription factors [BR:tup03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    102475580 (GLI3)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC IL17
Other DBs
NCBI-GeneID: 102475580
NCBI-ProteinID: XP_006143054
LinkDB
Position
Un
AA seq 1561 aa
MEAQSHSSATTEKKKVENSIVKCSTRTDVSEKAVASSTTSNEDESPGQTYHRERRNAITM
QPQSVQGLSKISEEPSTSSDERASLIKKEIHGSLPHLAEPSVPYRGTVFAMDPRNGYMEP
HYHPPHLFPAFHPPVPIDARHHEGRYHYDPSPIPPLHMPSALSSPTYPDLPFIRISPHRN
PAAASESPFSPPHPYINPYMDYIRSLHSSPSLSMISAARGLSPTDTPHAGVSPAEYYHQM
ALLTGQRSPYADILPSAATAGAGAIHMEYLHAMDSTRFSSPRLSARPSRKRTLSISPLSD
HSFDLQTMIRTSPNSLVTILNNSRSSSSASGSYGHLSASAISPALSFTYPSAPVSLHMHQ
QILSRQQSLGSAFGHSPPLIHPAPTFPTQRPIPGIPTVLNPVQVSSGPSESSQNKPTSES
AVSSTGDPMHNKRSKIKPDEDLPSPGARGQQEQPEGTTLVKEEGDKDESKQEPEVIYETN
CHWEGCTREFDTQEQLVHHINNDHIHGEKKEFVCRWLDCSREQKPFKAQYMLVVHMRRHT
GEKPHKCTFEGCTKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTH
SNEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPEAHVTKKQRGDIHPRPPPPRDSGSHSQ
SRSPGRPTQGALSEQKDLSNTTSKREECLQVKTVKAEKPMTSQPSPGGQSSCSSQQSPIS
NYSNSGLELPLTDGGSVGDLNAIDETPIMDSTISTATTALALQARRNPAGTKWMEHVKLE
RLKQVNGALPRLSPILPPKAPAVSPLIGNGALSSNSCSLGGPMTLLPSRTDLSGVDITML
NMLNRRDSNTSTISSAYLSSRRSSGISPCFSSRRSSEASQAEGRPQNVSVADSYDPISTD
ASRRSSEASQGEGLPSLLSLTPAQQYRLKAKYAAATGGPPPTPLPNMERMSLKTRMALLG
DSREPGMALPPVPPPRRCSDGGAHSYGRRLLPHDTLGTGVRRASDPVRTGPDTLPLPRAQ
RFSSLNSFHTPVAPPSMEKRSLVLQNYTRPEGSQPRPFHTSPCPPSITENVTLESLTMDA
DASLNDEDFLPDDVVQYLNSQNQAGFEQHFQNAVAEDSKAPHGPSDFDPPGLSDTQVSQR
YRALGQPCAQGSKSDLPIQWNEVSSGSADLSSSKLKCGPRPPVQQARALGLYSNVLGHPQ
NPSRTVAGLAGGYQTLGENGSSYSGPEHLAIHSGGGNTYHEQPYKAQQHGNCLNRQPVAP
GVLDGAFGAGLQGPKLKGTTVQGSGGLLDFGLSMVSGESAVNGMPTQDPVGQGYLTHQPL
SDSTQHQGPGRPGQQMLGQVGATSHISVYQGPEVCLSGPHGIGTQPCVSLGGGRRQALPR
GSLAVQQGQLGDTSQTCRVNGIKMEVQGQPHQLCSNVQNFSGQFYDQTVGFGQQDTKAGS
FSSSAASCLLQGVGTENSELLSPGANQVTSTVDSLDSHDLDGVQIDFDAIIDDGDHASLI
SGALSPSIIQNLSHSSSRLTTPRASLPFPGLSVSTTNMAIGDMSSLLTSLAEESKFLAVM
Q
NT seq 4686 nt   +upstreamnt  +downstreamnt
atggaggcccagtcccacagctccgcgaccactgagaagaagaaagtcgagaattccata
gtgaaatgctccactcggacagatgtcagcgagaaagctgttgcctccagcaccacgtcc
aatgaggatgaaagtcctggacagacctatcacagagagagaagaaacgccatcaccatg
caaccacagagtgtccagggactcagcaagatcagcgaggagccttcaacatcgagtgac
gagagggcctcgctgatcaagaaggagatccatggatccctgccacacctggcagagccc
tctgtcccttaccgtgggaccgtatttgccatggaccccaggaatgggtacatggagcct
cactatcaccctccccatctgtttcctgccttccatcctcctgtaccaattgatgcgaga
catcatgagggccgttaccattatgacccatctcctattcctccattgcatatgccttcc
gccttatctagcccgacctacccggacctgccctttattcggatctccccgcaccggaat
cccgctgcggcgtcggagtctcccttcagccctccgcacccgtacatcaacccgtacatg
gactacatccgctctctgcacagcagcccgtccctctccatgatctcggcagcccggggg
ctgagccccaccgacacaccgcacgctggagtcagccccgcggagtactaccatcagatg
gcgctgctcaccggtcagcgcagcccctatgcagacatccttccctccgctgccaccgcc
ggcgcgggcgccatccacatggagtatcttcatgccatggatagcaccagattctccagc
cccaggctgtcagccaggccgagccgaaagcgcacgctgtccatatcaccactgtccgat
catagctttgaccttcagaccatgataaggacgtctcccaactccttagtcaccattctc
aataattcccgtagcagttcctccgctagtggctcctacggccacttatctgcaagtgca
atcagccctgccttgagcttcacctacccttccgcgcctgtctctctccatatgcatcaa
cagatcctaagccgacagcaaagcttaggctcggcctttggacatagccctccactcatc
caccctgccccaactttcccaacacagaggcctattccaggaatccctacggttctgaac
cccgtccaggtcagctccggcccttccgagtcctctcagaacaagcccacaagtgagtct
gcagtgagcagcactggtgacccgatgcacaacaagcgatccaagatcaaacctgatgaa
gatctccccagcccgggggctcgggggcagcaggagcagccagaaggaaccacccttgtc
aaggaggaaggggacaaagatgaaagcaaacaggagcctgaagtcatctatgagaccaac
tgccactgggaaggctgcacgcgggagttcgacacccaggagcagctggtgcatcatata
aataatgaccatattcacggagagaagaaggagtttgtgtgccggtggcttgactgctcg
cgagagcagaaacccttcaaagcccagtacatgttggtagtgcatatgagaagacacacg
ggcgagaagccccacaaatgcacttttgaaggttgcacaaaggcctactcacgactagaa
aacttgaaaacgcacttgagatcccacactggagagaaaccgtacgtctgtgagcacgaa
ggttgcaacaaggctttctcgaacgcctctgaccgcgccaagcaccaaaacagaacacat
tccaatgagaaaccctatgtgtgtaaaatcccaggctgcactaagcgctacacagaccca
agctccctccggaaacacgtgaagacggtgcatggcccagaggctcatgtcactaagaag
cagcgtggggacatacaccctcggcccccacccccacgagattccggcagccattcacag
tccaggtcccccggacggccgacccagggagccctcagtgaacagaaggacctcagcaat
actacctcaaagcgggaagaatgcctccaggtgaaaacggtcaaggcagagaagcccatg
acatctcagccaagccctggtggtcagtcttcatgcagcagccaacagtcccccatcagc
aactattccaacagtgggctcgagcttcctctgaccgatggaggtagtgtgggcgacctc
aatgccatcgatgaaaccccaatcatggactcgaccatttccacggccaccacggccctc
gctttgcaagccaggagaaacccggcagggaccaaatggatggagcatgtgaaactagaa
cggctaaagcaagtgaatggcgcactcccacggctgagccccattctgccccccaaggcc
cctgcggtctctcctctaataggaaatggagcactgtccagtaatagctgcagcctgggt
gggcccatgactctcctccccagcaggaccgacctgtccggcgtggacatcaccatgttg
aacatgcttaaccgcagggacagcaacaccagcaccatcagctctgcctacctgagcagc
cgccgctcctcagggatctccccgtgtttctccagccggaggtccagcgaggcctcccag
gccgaaggccggccccagaacgtgagcgtggccgattcctatgaccccatctccaccgac
gcctcgcgcaggtccagcgaggccagtcagggcgaggggctccccagcctgctgagcctc
actcccgcccagcagtaccgcctgaaggccaagtacgccgctgccacgggtgggccacct
cccaccccgctgcccaacatggagaggatgagcctgaagaccaggatggccctgctgggg
gacagcagggagcccgggatggccctgccgcccgtgcccccaccccggagatgcagcgac
gggggcgcacacagctacggccgacgcctgctgccccacgacaccctggggaccggcgtg
agaagggccagcgaccctgtgaggaccggcccagacaccttgcccctccccagggctcag
cgtttcagtagtctgaacagcttccacactccggttgcaccgccatccatggaaaagcgg
agcttagtgctccagaactacacacggcctgagggcagccagcctcggcccttccacacg
tccccctgtccgcccagcatcacggagaatgtcactctggagtccctgaccatggacgcc
gatgccagcctgaacgatgaggacttcctgccggacgacgtggtacagtatttaaattcc
cagaaccaggcagggtttgagcagcacttccaaaacgccgtcgctgaggacagcaaagca
ccccatgggcccagcgacttcgacccgcctgggctttcggacacccaggtcagccagcgg
taccgagctctggggcagccctgcgcccaaggcagcaaaagcgacctgcccatccagtgg
aacgaagtgagctcaggcagcgcagacctgtcctcctccaagctgaaatgcggtccccgg
cccccagtgcagcaggcccgagccctcgggctgtacagcaatgtgctcggtcacccacag
aatccgtcacggactgtggctggcctggctgggggctatcagacactcggggagaacggc
agctcctacagtggcccagagcacttggcgatccacagtggcggtggaaacacataccat
gaacagccctacaaggcccagcaacacgggaactgtctcaacaggcaaccagtggccccc
ggggtgctagacggtgcctttggtgctgggcttcaagggccgaagctgaaaggcaccacc
gtgcaagggagtgggggcctgctggattttggcctgtccatggtgtcaggtgagtcagca
gtgaatggcatgccgacccaagacccagtgggacaggggtacctcactcaccagcctctc
agtgacagcacgcagcaccaggggccaggccgccccggtcagcagatgctagggcaggtt
ggtgctacctcacacatcagcgtctatcaagggccagaggtctgcctttcagggcctcac
ggcatcggcacccagccgtgtgtcagtctcgggggcggcaggcgccaggctttgccaaga
gggagcctcgctgtgcagcaaggacagctcggtgacacgagtcagacctgcagggtgaac
ggcatcaaaatggaggtgcaaggacagcctcatcagctctgttctaatgtgcagaatttc
tctggtcagttctatgaccaaactgtgggcttcggtcagcaagacacgaaagctggttct
ttctcctcgtcggcagccagctgcctgctgcagggggtgggcactgaaaactcggagtta
ctttccccaggtgctaaccaggtgaccagcacagttgacagcctcgacagccatgacctg
gatggggtgcagatcgattttgacgccatcatagacgacggggaccacgccagcctaatt
tcaggggccctgagcccaagcatcatccagaacctttcccatagctcctcccgcctcacc
acgccgcgggcgtctctcccattccctgggctctctgtgagcaccaccaacatggctatc
ggggacatgagttctttgctgacgtcccttgcggaagagagcaaattccttgcagttatg
cagtag

KEGG   Tupaia chinensis (Chinese tree shrew): 102500191
Entry
102500191         CDS       T02978                                 

Gene name
GLI2
Definition
(RefSeq) GLI family zinc finger 2
  KO
K16798  zinc finger protein GLI2
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04340  Hedgehog signaling pathway
tup04390  Hippo signaling pathway
tup05200  Pathways in cancer
tup05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102500191 (GLI2)
   04390 Hippo signaling pathway
    102500191 (GLI2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102500191 (GLI2)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    102500191 (GLI2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tup03000]
    102500191 (GLI2)
Transcription factors [BR:tup03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    102500191 (GLI2)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4
Other DBs
NCBI-GeneID: 102500191
NCBI-ProteinID: XP_006169659
LinkDB
Position
Un
AA seq 1436 aa
MPQHLLPPFHAPLPIDMRHQEGRYHYEPHSVHGVHGPPTLSGSPVISDISLIRLSPHPAG
PGESPFSAPHPYVSPHMEHYLRSVHSSPTLSMVSAARGLSPADVAHEHLKERGLFGLPAP
GSTPSDYYHQMTLMAGHPAPYGDLLMQSGGAAGAPHLHDYLNPVDVSRFSSPRVTPRLSR
KRALSISPLSDASLDLQRMIRTSPNSLVAYINNSRSSSAASGSYGHLSAGALSPAFTFPH
PINPVAYQQILSQQRGLGSAFGHTPPLMQPSPTFLAQQPLALTSVSATPTQLSSSNCLSD
ANQNKQSSESAVSSTVNPIAIHKRSKVKTEAEGLRPSSPLAPTQEQLTDFKEDLDRDDCK
QEAEVVIYETNCHWEDCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQ
YMLVVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNA
SDRAKHQNRTHSNEKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHIRA
PLLKENGDNEASAEPGHGSEESAEANSTSQAMEDCLHVKAIKTERSGLCQSSPGAQSSCS
SEPSPLGSAPNNDSGVEMPGTGPGSLGDLTSLDDMPPGADASPLAAPSAGGLQLRKHMTT
MHRFEQLKKEKLKSLKDSCSWAGPAPHTRNTKLPPLPGSGSIVENFSGSGGGGAAGLLPN
PRLSELSASEVTMLSQLQCSGAGSGLLNLTPAQQYSLRAKYAAATGGPPPPPLPGLERVS
LRTSGAGSGLLNLTPAQQYSLRAKYAAATGGPPPTPLPGLERVSLRTRPDILTLPRVQRF
HSAHSINPGALPSCSERRGFRLQSHLSADGCLARSVYSPRPPSITENVAMEAMAAGVDTG
GHEANLGLPEDDLVLPDDVVQYIKTHTSNALDDSAGHRYPMESASFSDSPKLPSPGLQSQ
RRMAAADSNVGSSAPVLGACQLGYVDPSDLNKNNMPVQWNEVSSGTMDAVASQAKPPPFP
QGNLAVVQQKTAFGQYSDYSPQGLQPSTGGLDSTQPHLQPRSGAPSAPRVTYMQQLRQPV
TGGHCPGMTTSVSPHSSYGQAHPQLSPSTVGGNLHQFPPSCSNMAAKPSHLGFPQQMDVA
PDPTMMGSRHRELGIPNLALAGMPQPHPAQSYPQQSHHLAVPMNQEGYRQGSGPLPSHQS
GFMEPQQGTMGVAASNFGLVQPRPPVEPSPVVRQRGVRAGQQQLAYARATSHAMAATSAS
QESAEAVPKGAVGAMASLPLQPPPQDAGGAQDSTLCYYGQIHMYEQNGGLENHGGFQVMR
PQPPQPQACPESIQPQPLPSPGVNQVSSTVDSQLLEAPQIDFDAIMDDGDHSSLFSGTLS
PSLLHSLSQNSSRLTTPRNSLTLPSVPAGISNMAVGDMSSMLSSLAEENRFLNMMT
NT seq 4311 nt   +upstreamnt  +downstreamnt
atgcctcagcacctcttgccaccattccatgcgcccttgccgattgacatgcgacaccag
gagggaaggtaccattacgagcctcactctgttcacggcgtgcacgggcctcccaccctg
agcggcagccctgtcatctccgatatctccctgatccggctttccccgcaccctgctggc
cctggggagtccccgttcagcgccccccacccctacgtgagcccccacatggagcactac
ctccgttccgtgcacagcagccccacgctctccatggtctctgcagccaggggcctcagc
cctgctgatgtggcccatgagcaccttaaggagagaggactattcggcctccctgctccc
ggctccaccccttcggactattaccaccagatgaccctcatggcgggccaccctgcaccc
tacggggatctgctgatgcagagtggaggcgctgctggtgcaccccatctccacgactac
ctcaacccagtggatgtgtcgcgtttctccagccctcgagtgacaccccgcctgagccgc
aaacgggcgctgtccatctccccgctctcagacgccagcctcgatctgcagcgtatgatc
cggacctcgcccaactcactggtggcctacatcaacaactcgcgcagcagctcggcggcc
agcggctcctatgggcacctgtcagcaggcgccctcagccctgccttcactttcccccac
cccatcaaccctgtggcctaccagcagatcctgagccagcagaggggcctgggctcagcc
tttggacacacaccacccctgatgcagccctcgcccaccttcctggcccagcagcccctg
gccctcacctccgtcagcgccacgcctacccagctcagcagcagcaactgtctgagtgat
gccaaccagaacaagcagagcagcgagtcggctgtgagcagtaccgtcaaccccatcgcc
attcacaagcgcagcaaggtcaagaccgaggctgagggcctgcggccaagctcccccttg
gcaccgacacaggagcagctgactgacttcaaggaagacctggaccgggacgactgcaag
caggaggctgaggtggtcatctatgagaccaactgccactgggaagactgtaccaaggag
tatgacacccaggagcagctggtgcaccacatcaacaacgagcacatccatggggagaag
aaggagttcgtgtgccgctggcaggcctgcacgcgggagcagaagcccttcaaggctcag
tacatgctggtggtgcacatgcggcggcacacaggcgagaagccgcacaagtgcacgttc
gagggctgctcaaaggcctattctcgcctggagaacctgaagacgcacctgcggtcccac
accggggagaagccatacgtctgtgagcacgagggctgcaacaaggccttctccaatgcc
tcggaccgtgccaagcatcagaaccgcacccactccaacgagaaaccctatatctgcaag
atcccaggctgcaccaagagatacacggaccccagctccctccggaagcacgtgaaaaca
gtccatggcccagacgctcatgtcaccaagaagcagcgcaatgatgtgcacattcgcgcc
ccgctgctcaaggagaacggggacaacgaggccagcgccgagcccggccacgggtccgag
gaaagtgctgaggccaacagcaccagtcaagccatggaggactgcttgcacgtcaaagcc
atcaagactgagcgctccgggctgtgtcagtctagccccggggcccagtcgtcctgcagc
agcgagccctctcccctgggcagtgcccccaacaatgacagcggtgtggagatgccgggg
acggggcccgggagcctgggagacctgacctcgctggatgacatgcccccgggagctgat
gcctcccccctggctgccccctcagctggtggcctgcaactgcgcaaacacatgaccacc
atgcaccggttcgagcagctcaagaaggagaagctcaagtcgctcaaggattcctgctcg
tgggctggaccagcaccacacacccggaataccaagctgcctccccttccgggaagtggc
tccattgtggaaaacttcagcggcagtggggggggcggggcggcgggtctgctgcccaac
ccgcggctgtccgagctgtctgcaagcgaggtcaccatgctgagccagctccaatgcagc
ggcgcaggctccgggctgctcaacctcacacccgcccagcagtacagcctgcgggccaag
tacgcggcggccaccggtgggccgccacccccgccgctgccaggcctggagcgcgtgagc
ctgcggaccagcggcgcaggctccgggctgctcaacctcacacccgcccagcagtacagc
ctgcgggccaagtacgcggcggccaccggtgggccgccacccacgccgctgccaggcctg
gagcgcgtgagcctgaggaccaggcccgacatcctgactctgccgcgggtgcagcgcttc
cacagtgcccacagcataaatccaggcgcgctcccgtcctgctccgagaggcgaggcttc
cgcctacagagccacctgagtgctgatggctgtttggcccgcagtgtctactcgccccgg
ccacccagcatcactgagaacgtggcgatggaagctatggcagcaggggtggacactggg
ggccacgaggctaacctggggctgcccgaggatgatctggtgctacccgatgacgtggtg
cagtacatcaagacacacaccagcaacgccctggatgacagtgctgggcacagatatccc
atggagagtgccagcttctctgacagccccaaactgcccagcccagggctgcagagtcag
cgcaggatggcagcagcagactccaatgtgggttcctctgcccctgtgctgggggcctgc
cagctgggctatgtggacccttctgacctgaacaaaaataacatgcctgtgcagtggaat
gaggtgagctcgggcaccatggatgccgtggccagccaagcaaagcctccaccctttcct
cagggcaacctagccgtggtgcagcagaagacagcctttggccagtactcagactacagt
ccacaaggcctacagccgagcactgggggcctggacagcacccagccccacctgcagccc
cgcagcggagccccttctgcacccagggtaacctacatgcaacagctgcgacagcccgtg
acaggtggccactgtccaggcatgaccacctctgtgagcccccacagcagctacggccaa
gcccacccccagctgagccccagcactgtcggtggcaacctgcaccagttccccccatcc
tgcagcaacatggcagccaagcccagccacctggggttccctcagcaaatggatgttgct
cctgaccccaccatgatgggcagccgccatagagaactcgggatccccaacttggctctg
gccggaatgccacaacctcacccagcacagagctacccacagcagagccatcacctggca
gtccccatgaaccaggagggctaccgccagggttccggccctctgccttcccaccagtca
ggcttcatggagccccagcagggcacaatgggagtggctgcatcaaacttcggcctagtg
caaccccggccgcccgtcgagcccagccctgttgttcgccaacgcggggtgcgtgctggg
cagcagcagctggcctatgccagggccaccagtcatgccatggctgccacatcagccagc
caggagtcagcagaggccgtgcccaaaggagcagtgggcgccatggcatcactgcctctt
cagccgcctccacaggacgcaggcggggcccaggacagcacactctgctactatggccag
atccacatgtatgaacagaatggcggactggagaaccacggaggcttccaggtcatgcgg
ccccagccacctcagccacaagcctgcccagagagcatccagccccagcccttgccctcg
ccaggggtcaaccaggtgtccagcactgttgactcccagctcctggaggccccccagatc
gactttgacgccatcatggatgatggcgatcactcgagcttgttttcggggacactgagc
cccagcctcctccatagtctctcccagaattcctcccgcctcaccacccccaggaattct
ctgactctgccctcggtccctgctggcatcagcaacatggccgtcggggacatgagctcc
atgctcagcagcctggctgaggagaacaggttcctcaacatgatgacctga

KEGG   Tupaia chinensis (Chinese tree shrew): 102501300
Entry
102501300         CDS       T02978                                 

Gene name
GLI1
Definition
(RefSeq) GLI family zinc finger 1
  KO
K16797  zinc finger protein GLI1
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04024  cAMP signaling pathway
tup04340  Hedgehog signaling pathway
tup05200  Pathways in cancer
tup05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102501300 (GLI1)
   04024 cAMP signaling pathway
    102501300 (GLI1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102501300 (GLI1)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    102501300 (GLI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tup03000]
    102501300 (GLI1)
Transcription factors [BR:tup03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    102501300 (GLI1)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4 IL17
Other DBs
NCBI-GeneID: 102501300
NCBI-ProteinID: XP_006171960
UniProt: L8XYV3
LinkDB
Position
Un
AA seq 1104 aa
MFNSMTPPPVSSYGEPCCLRPLPSQGATSMGTEGLSGLPFCHQANLMSSSHSYGPARETN
SCTEGPLFPPPRSAVKLTKKRALSISPLSDASLDLQTVIRTSPSSLVAFINSRCTSPGGS
YGHLSIGTMSPSLGFPPQMNHPKGTSPSFGVQACGPHDSTRGGMMPHPQSRGPLPTCQLK
SELDMLVGKCPEEALEGGMSSPNSTGTQDPLLGMLDGREDLEREEKPEPESVYETDCRWD
GCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTGEKP
HKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAKHQNRTHSNEK
PYVCKLPGCTKRYTDPSSLRKHVKTVHGPDAHVTKRHRGDGPLPRSSSLSTVEPKRERDG
GPIREESRLTVPEGAMKPQPSPGAQSSCSSDHSPAGSAANTDSGVEMTGNAGGSTEDLSS
LDEGSCIAGTGLSTLRRLENLRLDQLHQLRPLGPRGLKLPSLTHTGTPITRRVGPPVSLD
RRSSSSSSISSAYTVSRRSSLASPFPPGSPPENGASSLPGLTPAQHYLLRTRYASARGCG
TPPTAAPSLDRMGGLPAPPWRSRAEYPGYNPNAGVTRRASDPARVADRPAPARVQRFKSL
GCVHTPPAVAGGGRNFDPHLPASVYSPQPPSITENVAMDTRGLREEPVVGTSMMGSGLNP
YMDFPPADTLGYGVSEGAATEPYGTRGPGSLPLGPGPPTDYTPNPGPQPVSYPDPTPETW
VEFPSHTGPYPGPKAPGGTYSQCPRLEHYGQVQVKPEQGCLVGSDSTGLAPCLNAQPSEG
LPRPQPLFSHYSQPPPQYPQSGPYTQPPPDYLPSEPRPGLDFDSHAHSPGQLKAQLVCNY
LQSQQELLWEGGDRGDAPVQESYQSPKFLGGSQVSPSPTKAPVATYGPGFAPNLPNHKSG
SYPTPSPCHENFAVGTNRAPHRAAAAPRLLPPLPACYGPLKAGGTNPSCGHPEVGRPGAG
PALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEAQGLSPPPSHDQGSSSEHTPPPPGPPN
MAVGNMSVLLGSLPGETQFLNSSV
NT seq 3315 nt   +upstreamnt  +downstreamnt
atgttcaactcgatgaccccaccgccagtcagtagctatggcgagccctgctgtctccgg
cccctgcccagtcagggggccaccagcatggggacagaaggactgtctggtttgcccttc
tgccaccaagccaacctcatgtccagttcccacagttatgggcctgccagagagaccaac
agctgcaccgagggcccactcttccctcctccccggagtgcagtcaagctgactaagaag
cgggcactctccatctcgcctctgtcggatgccagcctggacctgcagacagttatccgc
acctcacccagctccctcgtggccttcatcaactctcgctgcacgtctccaggaggctcc
tatggccatctctccatcggcaccatgagtccatctctgggattcccaccccagatgaat
cacccaaaagggacctcaccttccttcggggtccaggcctgtggtccccatgattccacc
cgaggtgggatgatgccacatcctcagtcccggggaccgctgcccacttgtcagctgaag
tctgagctggacatgctggttggcaaatgcccggaggaggccttggaaggcggtatgtcc
agccccaactccacaggcacacaggaccctctgctggggatgctggatgggagagaggac
ctggagagagaggagaagcctgagcctgaatctgtgtatgagacggactgccgctgggat
ggctgcagccaggagtttgactcccaggagcagctggtgcaccacatcaacagcgagcac
atccacggggagcggaaggagtttgtgtgccactgggggggctgttccagggagctgagg
cccttcaaagcacagtacatgctggtggtgcacatgcgcagacacacgggcgagaagccg
cacaaatgcacgtttgaagggtgccgcaagtcgtactcacgtctcgaaaacctgaagacg
cacctgcggtcccacacgggtgagaagccatacatgtgtgagcacgagggctgcagtaaa
gccttcagcaatgccagtgaccgtgccaagcaccaaaatcggacccactccaatgagaag
ccgtatgtgtgtaagctccccggctgcaccaaacgctacacagatcccagctcgctccga
aaacatgtcaagacagtgcatggtcctgatgcccatgtgaccaagcggcaccgaggggat
ggccccctaccccggtcatcatccctttccacagtggagcccaagagggagcgggatgga
gggcccatcagggaggagagcagactgaccgtaccagagggtgccatgaagccacagccg
agccctggggcccagtcgtcctgcagcagtgaccactccccagcaggcagcgcggccaat
acggacagtggtgttgaaatgactggcaatgctgggggcagcaccgaggacctgtccagc
ttggacgaggggtcttgcattgctggcactggtctgtccactcttcgccgccttgagaac
ctcaggctggaccagctgcatcaactccggccactaggcccccggggtctcaaactgccc
agcttgacccacactggcacccccataactcgccgtgtgggccctccagtctctcttgac
cgccgcagcagcagctccagcagcatcagctctgcctacactgtcagccgccgctcctct
ctggcctcaccattcccccctggctccccaccagagaatggggcatcctcccttcctggc
ctcacacctgcccagcactacctgctccgaacaagatacgcttcagccagggggtgtggt
accccacctacagcagcacccagcttggatcgaatggggggcctccctgcacctccttgg
agaagccgagctgagtatccaggctacaaccccaacgcgggagtcactcggagggccagt
gacccagctcgggttgctgaccgtcctgctccagccagagtccagcggttcaagagcctg
ggctgtgtccacacacctcccgctgtggcaggaggagggcggaacttcgatccccacctc
ccagcctctgtctattcaccacagccccccagcatcactgagaatgtagccatggatact
agaggactacgggaggagccggtggttgggacctccatgatgggcagtggtctgaacccc
tatatggattttccacctgctgacactctgggctatggggtatctgaaggggcagcgact
gagccttatggaactaggggtccaggctccctgcctcttgggcctggtccacccactgac
tatacccccaaccccggtcctcagccagtctcctatcctgaccccaccccagaaacatgg
gttgagttcccttcccacaccgggccatacccaggccccaaggctccaggtggaacctac
agccaatgccctcgacttgaacattatggacaagtgcaagtcaagccagaacaggggtgc
ctggtggggtctgactccacaggactggcaccctgcctcaatgctcagcccagtgagggg
ctcccgcgcccacagcctctcttctcccactactcgcagcccccaccccaatatcctcag
tcaggcccctatacccagccaccccctgactatcttccttcagagcccaggcctggcctg
gattttgattcccatgctcattctccaggacagctcaaggctcagcttgtgtgtaattac
cttcagtctcaacaggagttgctgtgggagggtggagacagaggagatgccccagttcag
gaatcctaccagagtcccaagtttctgggaggttcccaggttagcccaagtcccaccaag
gccccagtagccacatatggacctggctttgcacccaacttgcccaatcataaatcaggc
tcttatcccaccccttcaccatgccatgaaaattttgcagtggggacaaacagggctccc
cacagagcagctgcagctcctcgacttctgccccccctgcctgcttgctatgggcctctc
aaggcagggggcaccaaccccagctgtggccatcccgaggtaggcaggcccggagcgggt
cctgccttgtaccctcctcctgaagggcaagtgtgtaaccctctggactctctcgatctt
gacaacactcagctggactttgtggctattctggatgaggcccaggggctgagtcctccc
ccttcccatgatcaggggagcagttctgaacacaccccacctcctcctggaccccccaac
atggctgtgggcaacatgagtgtcttactgggatctctgcctggggagacacaattcctc
aactctagtgtctaa

DBGET integrated database retrieval system