KEGG   Tupaia chinensis (Chinese tree shrew): 102475773
Entry
102475773         CDS       T02978                                 

Gene name
PLA2G3
Definition
(RefSeq) phospholipase A2 group III
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00564  Glycerophospholipid metabolism
tup00565  Ether lipid metabolism
tup00590  Arachidonic acid metabolism
tup00591  Linoleic acid metabolism
tup00592  alpha-Linolenic acid metabolism
tup01100  Metabolic pathways
tup04014  Ras signaling pathway
tup04270  Vascular smooth muscle contraction
tup04972  Pancreatic secretion
tup04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102475773 (PLA2G3)
   00565 Ether lipid metabolism
    102475773 (PLA2G3)
   00590 Arachidonic acid metabolism
    102475773 (PLA2G3)
   00591 Linoleic acid metabolism
    102475773 (PLA2G3)
   00592 alpha-Linolenic acid metabolism
    102475773 (PLA2G3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102475773 (PLA2G3)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102475773 (PLA2G3)
  09154 Digestive system
   04972 Pancreatic secretion
    102475773 (PLA2G3)
   04975 Fat digestion and absorption
    102475773 (PLA2G3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tup03036]
    102475773 (PLA2G3)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     102475773 (PLA2G3)
Chromosome and associated proteins [BR:tup03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    102475773 (PLA2G3)
SSDB
Motif
Pfam: Phospholip_A2_2 Chromadorea_ALT
Other DBs
NCBI-GeneID: 102475773
NCBI-ProteinID: XP_006148008
UniProt: L9KUT4
LinkDB
Position
Un
AA seq 509 aa
MGVLPALLRLLGFLGVALGGSPALHWDSTSCYLDRPIPGSPLRSLSFLGKDAQGAALYHA
HWDARRRLRGCSRQDEPELTAVFAAVCAHESTRGSFIHTPGPELQRALNTLRSQWDTCRE
PEERPAGAREKRAAGRSGAHQRRRRGWTMPGTLWCGVGDSAGNSSQLGIFQGPDLCCREH
DLCPQNISPLQYNYGIRNYRFHTISHCDCDARFRQCLRNQRDSISDIVGVAFFNVLETPC
FVLEEQEACVAWYWWGGCRKYGSALLARLQPRTQYNASWNSPATSLTPSPQPPAATKAQQ
KQHPSKQLKGSEHPSKANVAALQASVASPRPDVAPTAQPGSSHPDRQGPQASLKPRGPRR
ACRSFRRLDQCEHQIGPQETKFQLHNAAQEPLFHCNCTRRLARNAKLHGLPAGTSVLWEL
LGTTCFKLAPPLVCAEGKGCSRDPRAIKVSAQHLRRLQQRRLQFQDTGTAEGQVWPSEDT
GAPVSFYDQCLKLTQAAQRPDGRQKSWSQ
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgggggttctgccagcgctcttgagattgctgggctttctgggggtagctctggggggc
tcccctgctctccactgggacagtacctcctgctacctggacagacccatccctggcagc
cccctgaggtccctgagcttcctgggcaaggatgcccagggagcggccttgtaccacgcc
cactgggatgcgcgcaggaggctgcggggttgtagccggcaggatgaacccgagctcact
gctgttttcgctgccgtctgtgctcacgagagcactcggggctccttcatccacacccct
ggacctgagctgcagagagctctgaacacccttcggagtcagtgggacacctgccgagag
cctgaggagaggccggcaggggccagagagaagcgagcggcagggcggagcggagcgcac
cagcgaaggaggagaggctggaccatgccgggcacgctgtggtgtggcgtcggggactcc
gctgggaactcctcgcagctggggatcttccagggccccgatctctgctgtcgggagcat
gacctctgtccacagaacatctcgcccttgcagtacaactacggcatccggaactaccga
ttccacaccatctcccactgcgactgtgacgccagattccggcaatgcctgaggaaccag
cgtgactccatctcagacatcgtgggcgtggccttcttcaacgtgctggagaccccctgt
ttcgtgctggaggagcaggaggcctgtgtggcgtggtactggtggggcgggtgcaggaag
tatggctcggcgctgcttgcccgcctccagcccaggacccagtacaatgcatcctggaac
tctccagccacctccctgacccctagcccccaacccccagctgctaccaaagcacaacag
aagcagcatccttcaaagcagctgaaagggtccgagcatcccagcaaagccaacgtcgca
gccctccaggcttccgtggcctctcccaggcctgatgtggcacccacagcccaaccaggg
agctcccatccagaccgccagggcccacaggctagcctaaaacctcgaggtccccgacgg
gcctgccgcagcttccgccgcctggaccagtgtgagcaccagattgggccccaggaaacc
aagttccagctgcacaacgcagcccaggagcccctcttccactgtaactgcacacgccgt
ctggcgcgcaacgcgaagctccatggcctacctgcgggcaccagtgtgctttgggagctg
ctgggcacgacctgcttcaagctggctcctccactggtctgtgcagagggcaaaggctgt
tccagagaccccagggccatcaaggtgtcagctcagcacttgcggcggcttcagcaaagg
cgactccagttccaggatacaggcacagctgagggacaggtgtggccttcggaggacaca
ggagcccccgtgtcattctatgaccagtgcctgaagctaacccaggcagcccaaagacct
gacgggaggcagaaatcatggagccagtga

KEGG   Tupaia chinensis (Chinese tree shrew): 102476007
Entry
102476007         CDS       T02978                                 

Gene name
PLA2G10
Definition
(RefSeq) group 10 secretory phospholipase A2
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00564  Glycerophospholipid metabolism
tup00565  Ether lipid metabolism
tup00590  Arachidonic acid metabolism
tup00591  Linoleic acid metabolism
tup00592  alpha-Linolenic acid metabolism
tup01100  Metabolic pathways
tup04014  Ras signaling pathway
tup04270  Vascular smooth muscle contraction
tup04972  Pancreatic secretion
tup04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102476007 (PLA2G10)
   00565 Ether lipid metabolism
    102476007 (PLA2G10)
   00590 Arachidonic acid metabolism
    102476007 (PLA2G10)
   00591 Linoleic acid metabolism
    102476007 (PLA2G10)
   00592 alpha-Linolenic acid metabolism
    102476007 (PLA2G10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102476007 (PLA2G10)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102476007 (PLA2G10)
  09154 Digestive system
   04972 Pancreatic secretion
    102476007 (PLA2G10)
   04975 Fat digestion and absorption
    102476007 (PLA2G10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tup03036]
    102476007 (PLA2G10)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     102476007 (PLA2G10)
Chromosome and associated proteins [BR:tup03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    102476007 (PLA2G10)
SSDB
Motif
Pfam: Phospholip_A2_1
Other DBs
NCBI-GeneID: 102476007
NCBI-ProteinID: XP_006146616
UniProt: L9KXZ2
LinkDB
Position
Un
AA seq 181 aa
MQPLPGSALPLGKTSHTCFRPVALLSLCLVLALLLLLLLLSPGPGPSVASRKSHVRRRGV
LDLAKVVTCVGPRSPFAYIKYGCFCGLGGYGQPRDDIDWCCHRHDCCYTRAEEAGCRPKI
DSYAWQCVNQTILCGPTGNTCEELLCKCDQELAYCFAQAKYNIKFLFYLQFLCEENSPKC
D
NT seq 546 nt   +upstreamnt  +downstreamnt
atgcagccactacctggctccgccttgccgctggggaagacgtctcacacctgcttccgc
ccggtggccttgctgtccctgtgcctggtattagcgctgctgctgctgctgctgctgctg
agccctggacccggacccagcgtggcctccaggaagtcacatgtccgccggcgcggggtc
ctggatctggcgaaggttgtgacttgtgttggcccccgaagccccttcgcctacatcaag
tatggctgcttttgtggcctgggtggctatggccagccccgggatgacatcgactggtgc
tgccatcgccacgactgctgttacactcgggctgaggaggctggctgcagacccaagata
gacagctacgcctggcagtgtgtcaatcagaccatcctgtgtggaccaacagggaacaca
tgtgaagaactcctgtgcaaatgtgaccaggagctcgcctactgctttgcccaagctaag
tacaacataaaattcctcttctacttgcagttcctatgtgaggagaactcgcccaagtgt
gactga

KEGG   Tupaia chinensis (Chinese tree shrew): 102480654
Entry
102480654         CDS       T02978                                 

Gene name
PLA2G12A
Definition
(RefSeq) phospholipase A2 group XIIA
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00564  Glycerophospholipid metabolism
tup00565  Ether lipid metabolism
tup00590  Arachidonic acid metabolism
tup00591  Linoleic acid metabolism
tup00592  alpha-Linolenic acid metabolism
tup01100  Metabolic pathways
tup04014  Ras signaling pathway
tup04270  Vascular smooth muscle contraction
tup04972  Pancreatic secretion
tup04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102480654 (PLA2G12A)
   00565 Ether lipid metabolism
    102480654 (PLA2G12A)
   00590 Arachidonic acid metabolism
    102480654 (PLA2G12A)
   00591 Linoleic acid metabolism
    102480654 (PLA2G12A)
   00592 alpha-Linolenic acid metabolism
    102480654 (PLA2G12A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102480654 (PLA2G12A)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102480654 (PLA2G12A)
  09154 Digestive system
   04972 Pancreatic secretion
    102480654 (PLA2G12A)
   04975 Fat digestion and absorption
    102480654 (PLA2G12A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tup03036]
    102480654 (PLA2G12A)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     102480654 (PLA2G12A)
Chromosome and associated proteins [BR:tup03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    102480654 (PLA2G12A)
SSDB
Motif
Pfam: PLA2G12
Other DBs
NCBI-GeneID: 102480654
NCBI-ProteinID: XP_006162302
LinkDB
Position
Un
AA seq 188 aa
MALLPRPALALLLVVAAAVMGQEQEQTTDWRATLKTIRNGVHRIDTYLNAALDLLGGEDG
LCRYKCSDGSKPLPRYGFKPSPPSGCGSPLFGVHLNVGIPSLTRCCNQHDRCYETCGHSK
SDCDEQFQACLSKICRDVQRTLGLAQHVQACETAVGLLFDSVIHLGCKPYLDSQRAACRC
RHEEKTDL
NT seq 567 nt   +upstreamnt  +downstreamnt
atggccctgctcccgcggcccgcgctggccctcctgctcgtcgtggccgccgccgtcatg
ggccaggagcaggagcagaccaccgactggagggcgaccctgaagaccatccgcaacggc
gtgcaccgcatagacacgtacctgaacgccgccctggacctgctgggcggcgaggacggc
ctctgccggtacaagtgcagcgacggctcgaagcctcttccacgttatggctttaagccc
tcccctccgagcggctgtggctctccgctgtttggtgttcatctgaacgtgggcatcccc
tcgctgacgcggtgctgcaaccagcatgaccgctgctacgagacctgcggccacagcaag
agcgactgcgacgagcagttccaggcctgcctctccaagatctgccgcgatgtgcagcgg
acactcgggctggctcagcatgtgcaggcgtgcgagacggcggtggggctcctgttcgac
agcgtcatccacctgggctgtaagccgtacctggacagccagcgggccgcctgcaggtgt
cgccatgaggagaagaccgacctctga

KEGG   Tupaia chinensis (Chinese tree shrew): 102488847
Entry
102488847         CDS       T02978                                 

Gene name
PLA2G12B
Definition
(RefSeq) phospholipase A2 group XIIB
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00564  Glycerophospholipid metabolism
tup00565  Ether lipid metabolism
tup00590  Arachidonic acid metabolism
tup00591  Linoleic acid metabolism
tup00592  alpha-Linolenic acid metabolism
tup01100  Metabolic pathways
tup04014  Ras signaling pathway
tup04270  Vascular smooth muscle contraction
tup04972  Pancreatic secretion
tup04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102488847 (PLA2G12B)
   00565 Ether lipid metabolism
    102488847 (PLA2G12B)
   00590 Arachidonic acid metabolism
    102488847 (PLA2G12B)
   00591 Linoleic acid metabolism
    102488847 (PLA2G12B)
   00592 alpha-Linolenic acid metabolism
    102488847 (PLA2G12B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102488847 (PLA2G12B)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102488847 (PLA2G12B)
  09154 Digestive system
   04972 Pancreatic secretion
    102488847 (PLA2G12B)
   04975 Fat digestion and absorption
    102488847 (PLA2G12B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tup03036]
    102488847 (PLA2G12B)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     102488847 (PLA2G12B)
Chromosome and associated proteins [BR:tup03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    102488847 (PLA2G12B)
SSDB
Motif
Pfam: PLA2G12
Other DBs
NCBI-GeneID: 102488847
NCBI-ProteinID: XP_006170138
LinkDB
Position
Un
AA seq 194 aa
MRLATSFLILWFSLGGGLAQSDTDSETEESYSDWGLRQIRGSFESVNSYFDSFLELLGGR
NGVCQYRCRYGKAPMPRPGYKPQEPNGCSSYFLGLKVPESMDLGIPAMTKCCNQLDVCYD
TCGANKYRCDAKFRWCLHSICSDLKRSLGFVSNVEVACDSLADTVFNTVWTLGCRPFMNS
QRAACICAEEKEEL
NT seq 585 nt   +upstreamnt  +downstreamnt
atgaggctggccaccagcttcttgattctgtggttcagccttgggggtggcctggctcag
agtgacactgactcagaaacagaggagtcctactcggactgggggctccggcaaatccgg
ggcagctttgaatctgtcaacagctacttcgattcctttctggagctgctgggagggagg
aatggtgtatgccagtaccggtgccgatacggaaaggcaccaatgcccagacctggctac
aagcctcaggagcccaacggctgcagctcctatttcctgggtctcaaggtaccagaaagt
atggacttgggcatcccagcaatgaccaagtgctgcaaccagctggatgtctgctatgac
acttgcggtgccaacaaatatcgctgtgatgcaaaattccgatggtgtctccactccatc
tgctctgaccttaagcggagcctgggctttgtctccaacgtggaagtagcctgtgactcc
ctggctgatactgtgttcaacactgtatggactctgggctgccgaccctttatgaatagt
caacgggcagcctgcatctgtgcagaagagaaggaagagttatga

KEGG   Tupaia chinensis (Chinese tree shrew): 102496651
Entry
102496651         CDS       T02978                                 

Gene name
PLA2G2F
Definition
(RefSeq) phospholipase A2 group IIF
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00564  Glycerophospholipid metabolism
tup00565  Ether lipid metabolism
tup00590  Arachidonic acid metabolism
tup00591  Linoleic acid metabolism
tup00592  alpha-Linolenic acid metabolism
tup01100  Metabolic pathways
tup04014  Ras signaling pathway
tup04270  Vascular smooth muscle contraction
tup04972  Pancreatic secretion
tup04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102496651 (PLA2G2F)
   00565 Ether lipid metabolism
    102496651 (PLA2G2F)
   00590 Arachidonic acid metabolism
    102496651 (PLA2G2F)
   00591 Linoleic acid metabolism
    102496651 (PLA2G2F)
   00592 alpha-Linolenic acid metabolism
    102496651 (PLA2G2F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102496651 (PLA2G2F)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102496651 (PLA2G2F)
  09154 Digestive system
   04972 Pancreatic secretion
    102496651 (PLA2G2F)
   04975 Fat digestion and absorption
    102496651 (PLA2G2F)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tup03036]
    102496651 (PLA2G2F)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     102496651 (PLA2G2F)
Chromosome and associated proteins [BR:tup03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    102496651 (PLA2G2F)
SSDB
Motif
Pfam: Phospholip_A2_1 Parvo_coat_N
Other DBs
NCBI-GeneID: 102496651
NCBI-ProteinID: XP_006145486
LinkDB
Position
Un
AA seq 211 aa
MADGAHASPKGFRKKVLVRCPSGQRGPSLRASSPSRTSRSTLGMKKFFTVAILAGSVLSA
AHGSLLNLKSMVEVITGRNAILSFVGYGCYCGLGGRGRPMDEVDWCCHAHDCCYQKLFDL
GCRPYVDHYDYTIENNTVIVCSELNKTECDKQTCACDKDVALCLQSQVYREELRGYLNIY
CQGPQPNCSIYEPPPEEVACPPGSLGTPAPL
NT seq 636 nt   +upstreamnt  +downstreamnt
atggcagatggggcgcatgccagccccaaagggttcaggaagaaggtgctggttagatgc
ccctctgggcagaggggcccgagcctcagggcctcctctccttcaagaacctccaggtct
accctgggtatgaagaagttcttcaccgtcgccattctggctggcagtgttctgtccgca
gcccatggaagcctgctcaacctgaagtccatggtggaggtcatcaccgggaggaacgcc
atcctgtccttcgtgggctacggctgctactgcgggctgggaggccgcggccggcccatg
gacgaggtggactggtgctgccacgcccacgactgctgctaccagaagctcttcgacctg
ggctgccgcccctatgtggaccactacgactacaccatcgagaataacaccgtgatagtc
tgcagcgagctcaacaagacggagtgcgacaagcagacctgtgcatgcgacaaggacgtg
gctctgtgtctccagagccaggtgtacagggaggagctccgcggctacctcaacatctac
tgccaaggtccccagcccaactgcagcatctacgagcctcctcctgaggaggtggcctgc
ccaccgggctccctgggcacccctgccccactctag

KEGG   Tupaia chinensis (Chinese tree shrew): 102497076
Entry
102497076         CDS       T02978                                 

Gene name
PLA2G5
Definition
(RefSeq) phospholipase A2 group V
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00564  Glycerophospholipid metabolism
tup00565  Ether lipid metabolism
tup00590  Arachidonic acid metabolism
tup00591  Linoleic acid metabolism
tup00592  alpha-Linolenic acid metabolism
tup01100  Metabolic pathways
tup04014  Ras signaling pathway
tup04270  Vascular smooth muscle contraction
tup04972  Pancreatic secretion
tup04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102497076 (PLA2G5)
   00565 Ether lipid metabolism
    102497076 (PLA2G5)
   00590 Arachidonic acid metabolism
    102497076 (PLA2G5)
   00591 Linoleic acid metabolism
    102497076 (PLA2G5)
   00592 alpha-Linolenic acid metabolism
    102497076 (PLA2G5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102497076 (PLA2G5)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102497076 (PLA2G5)
  09154 Digestive system
   04972 Pancreatic secretion
    102497076 (PLA2G5)
   04975 Fat digestion and absorption
    102497076 (PLA2G5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tup03036]
    102497076 (PLA2G5)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     102497076 (PLA2G5)
Chromosome and associated proteins [BR:tup03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    102497076 (PLA2G5)
SSDB
Motif
Pfam: Phospholip_A2_1
Other DBs
NCBI-GeneID: 102497076
NCBI-ProteinID: XP_006145487
LinkDB
Position
Un
AA seq 240 aa
MVSLQEGDVSTEIIHKQRELHVKTEVETEVTCPKAEEHQRGQVSEPELGDSLELVLPHSP
RTEAAVSARLSSASGWFMAVEEFPGPDGKQIEKMYSLSKTPELKGLLTLAWLLACSVPVV
PGSLLDLKSMIEKVTGKNALKCYGFYGCYCGWGGQGIPKDGTDWCCWMHDNCYGQLEAKH
CNIRTQSYKYRFAWGLVTCEPAPLCQMQLCACDRNLVYCLKRNLWSYNPFYQYFPNVFCS
NT seq 723 nt   +upstreamnt  +downstreamnt
atggtgtccttacaagaaggagacgtgtcgacagagataatccataagcagagagaactc
cacgtgaagacggaggtggaaactgaagtgacgtgtccgaaagccgaggagcaccaaagg
gggcaggtcagtgagccggagctgggagacagcctggaactggttctccctcacagtccg
cgcacagaagcagccgtgtcggcacgtctaagctctgcctctggatggttcatggccgtg
gaagaattcccaggcccagacggtaagcagatagaaaagatgtactcactttccaaaacc
ccggagctgaagggcctcctcacactggcttggctcctggcttgcagtgtgcctgtggtg
ccgggaagcttgcttgacctcaagtccatgatcgagaaagtgactgggaagaacgccctg
aagtgctatggcttctatggctgctactgtggctggggtggccaagggatccccaaggat
ggcaccgactggtgctgctggatgcatgacaactgctacgggcagctggaggcgaaacac
tgcaacatccggacacagtcgtacaaatacagatttgcttggggcctggtcacctgcgag
ccggcacccctctgtcagatgcagctctgtgcctgcgaccggaacctcgtgtactgcctg
aagaggaacctgtggagctacaaccctttctaccagtacttccccaacgtcttctgctcc
tag

KEGG   Tupaia chinensis (Chinese tree shrew): 102499549
Entry
102499549         CDS       T02978                                 

Gene name
PLA2G2C
Definition
(RefSeq) phospholipase A2 group IIC
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00564  Glycerophospholipid metabolism
tup00565  Ether lipid metabolism
tup00590  Arachidonic acid metabolism
tup00591  Linoleic acid metabolism
tup00592  alpha-Linolenic acid metabolism
tup01100  Metabolic pathways
tup04014  Ras signaling pathway
tup04270  Vascular smooth muscle contraction
tup04972  Pancreatic secretion
tup04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102499549 (PLA2G2C)
   00565 Ether lipid metabolism
    102499549 (PLA2G2C)
   00590 Arachidonic acid metabolism
    102499549 (PLA2G2C)
   00591 Linoleic acid metabolism
    102499549 (PLA2G2C)
   00592 alpha-Linolenic acid metabolism
    102499549 (PLA2G2C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102499549 (PLA2G2C)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102499549 (PLA2G2C)
  09154 Digestive system
   04972 Pancreatic secretion
    102499549 (PLA2G2C)
   04975 Fat digestion and absorption
    102499549 (PLA2G2C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tup03036]
    102499549 (PLA2G2C)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     102499549 (PLA2G2C)
Chromosome and associated proteins [BR:tup03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    102499549 (PLA2G2C)
SSDB
Motif
Pfam: Phospholip_A2_1 Parvo_coat_N Phospholip_A2_2
Other DBs
NCBI-GeneID: 102499549
NCBI-ProteinID: XP_006145255
LinkDB
Position
Un
AA seq 152 aa
MKVIAVLIVVISCWMAPTRSSFWQFQRMVKHVTGRSAFFSYNGYGCYCGLGGKGVPVDDT
DRCCLAHDCCYEKLKESGCQPVLNSYRFHVANGTVVCGCTLSPGVGCLCGLKACECDKRS
VYCFRDSLPTYEKNFKQVFSNRPRCGRRRLQC
NT seq 459 nt   +upstreamnt  +downstreamnt
atgaaggtcattgctgttctcatcgttgtcatctcttgctggatggcccccacccgcagc
agcttctggcagttccagaggatggtcaagcacgtcacagggcggagtgccttcttctcc
tacaacggatatggctgctactgtggacttgggggcaaaggggtccccgtggatgacact
gaccggtgttgcctggcacatgactgctgctacgagaagctgaaagagtccggctgccag
cctgtgctgaacagttaccggttccacgtcgccaacggcacggtggtctgtgggtgcacc
ctgagccctggagtcggctgcctgtgtgggctgaaggcctgtgagtgtgacaagcgatct
gtgtactgcttcagggacagcctgcccacctacgagaagaactttaagcaggtcttctcc
aaccggccccggtgcggcaggcgtagactccagtgctag

KEGG   Tupaia chinensis (Chinese tree shrew): 102501355
Entry
102501355         CDS       T02978                                 

Gene name
PLA2G2D
Definition
(RefSeq) phospholipase A2 group IID
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00564  Glycerophospholipid metabolism
tup00565  Ether lipid metabolism
tup00590  Arachidonic acid metabolism
tup00591  Linoleic acid metabolism
tup00592  alpha-Linolenic acid metabolism
tup01100  Metabolic pathways
tup04014  Ras signaling pathway
tup04270  Vascular smooth muscle contraction
tup04972  Pancreatic secretion
tup04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102501355 (PLA2G2D)
   00565 Ether lipid metabolism
    102501355 (PLA2G2D)
   00590 Arachidonic acid metabolism
    102501355 (PLA2G2D)
   00591 Linoleic acid metabolism
    102501355 (PLA2G2D)
   00592 alpha-Linolenic acid metabolism
    102501355 (PLA2G2D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102501355 (PLA2G2D)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102501355 (PLA2G2D)
  09154 Digestive system
   04972 Pancreatic secretion
    102501355 (PLA2G2D)
   04975 Fat digestion and absorption
    102501355 (PLA2G2D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tup03036]
    102501355 (PLA2G2D)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     102501355 (PLA2G2D)
Chromosome and associated proteins [BR:tup03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    102501355 (PLA2G2D)
SSDB
Motif
Pfam: Phospholip_A2_1
Other DBs
NCBI-GeneID: 102501355
NCBI-ProteinID: XP_006145260
UniProt: L9L1C5
LinkDB
Position
Un
AA seq 145 aa
MALLLLCALLVMAGVTPAQGGILNLNKMIKQVTGKTPILSYWPYGCHCGLGGRGQPKDAT
DWCCHAHDCCYAYLKAHKCRIHSDLYKYSFSQGDIHCSSHGTWCEQQLCACDKEMAFCLQ
RNLGTYQKSWRYLRRASCQGQKPGC
NT seq 438 nt   +upstreamnt  +downstreamnt
atggcacttctgctattgtgtgcgcttctggtgatggcgggtgtgacgccagcccagggt
gggatcctgaacctgaacaagatgatcaagcaagtgactgggaagacgcctatcttgtcc
tactggccctacggctgtcactgcggacttggtggcagaggccagcccaaagatgccaca
gattggtgctgccatgcccacgactgctgctacgcctacctgaaggcccacaaatgccgg
atccattcggacctctacaagtacagcttttcccagggcgacatccactgctccagccac
gggacctggtgtgagcagcagctgtgcgcctgtgacaaggagatggccttctgcctgcag
cgcaacctgggcacctaccagaagagctggcgctacctcaggcgggccagctgccagggt
cagaaaccgggatgctga

KEGG   Tupaia chinensis (Chinese tree shrew): 102501534
Entry
102501534         CDS       T02978                                 

Gene name
PLA2G1B
Definition
(RefSeq) phospholipase A2 group IB
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00564  Glycerophospholipid metabolism
tup00565  Ether lipid metabolism
tup00590  Arachidonic acid metabolism
tup00591  Linoleic acid metabolism
tup00592  alpha-Linolenic acid metabolism
tup01100  Metabolic pathways
tup04014  Ras signaling pathway
tup04270  Vascular smooth muscle contraction
tup04972  Pancreatic secretion
tup04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102501534 (PLA2G1B)
   00565 Ether lipid metabolism
    102501534 (PLA2G1B)
   00590 Arachidonic acid metabolism
    102501534 (PLA2G1B)
   00591 Linoleic acid metabolism
    102501534 (PLA2G1B)
   00592 alpha-Linolenic acid metabolism
    102501534 (PLA2G1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102501534 (PLA2G1B)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102501534 (PLA2G1B)
  09154 Digestive system
   04972 Pancreatic secretion
    102501534 (PLA2G1B)
   04975 Fat digestion and absorption
    102501534 (PLA2G1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tup03036]
    102501534 (PLA2G1B)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     102501534 (PLA2G1B)
Chromosome and associated proteins [BR:tup03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    102501534 (PLA2G1B)
SSDB
Motif
Pfam: Phospholip_A2_1 Parvo_coat_N
Other DBs
NCBI-GeneID: 102501534
NCBI-ProteinID: XP_006151598
LinkDB
Position
Un
AA seq 146 aa
MKLLVLAALLTVATAESSVSPRALWQFRSMIKCTIPGSDPLRDYNNYGCYCGLGGSGTPV
DELDTCCQTHDHCYDQAKKLSSCKFLLDNPYTKTYSYTCSGSEITCNSKNNECQAFICNC
DRNAAICFSKVPYNKEYKNLDTKKYC
NT seq 441 nt   +upstreamnt  +downstreamnt
atgaaactccttgtgctggccgctctgctcacagtggccactgccgagagcagtgtcagt
ccgcgggcactgtggcagttccgcagcatgatcaagtgcacgatccctggcagcgacccc
ttgagagactacaacaactacggctgctactgcggcctgggaggctcgggcacgccggtg
gatgaactggacacgtgctgtcagacacatgaccactgctatgaccaggccaagaagctg
agcagttgtaaattcctcctggacaacccgtacaccaagacctactcgtacacgtgctcc
ggctccgagatcacctgcaacagcaaaaacaatgagtgccaggccttcatctgcaactgc
gaccgcaacgcggccatctgcttttcaaaggtcccctacaacaaggagtacaagaacctg
gacaccaagaagtattgctag

KEGG   Tupaia chinensis (Chinese tree shrew): 102501775
Entry
102501775         CDS       T02978                                 

Gene name
PLA2G2A
Definition
(RefSeq) phospholipase A2 group IIA
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00564  Glycerophospholipid metabolism
tup00565  Ether lipid metabolism
tup00590  Arachidonic acid metabolism
tup00591  Linoleic acid metabolism
tup00592  alpha-Linolenic acid metabolism
tup01100  Metabolic pathways
tup04014  Ras signaling pathway
tup04270  Vascular smooth muscle contraction
tup04972  Pancreatic secretion
tup04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102501775 (PLA2G2A)
   00565 Ether lipid metabolism
    102501775 (PLA2G2A)
   00590 Arachidonic acid metabolism
    102501775 (PLA2G2A)
   00591 Linoleic acid metabolism
    102501775 (PLA2G2A)
   00592 alpha-Linolenic acid metabolism
    102501775 (PLA2G2A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102501775 (PLA2G2A)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102501775 (PLA2G2A)
  09154 Digestive system
   04972 Pancreatic secretion
    102501775 (PLA2G2A)
   04975 Fat digestion and absorption
    102501775 (PLA2G2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tup03036]
    102501775 (PLA2G2A)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     102501775 (PLA2G2A)
Chromosome and associated proteins [BR:tup03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    102501775 (PLA2G2A)
SSDB
Motif
Pfam: Phospholip_A2_1 Parvo_coat_N
Other DBs
NCBI-GeneID: 102501775
NCBI-ProteinID: XP_006145261
UniProt: L9L022
LinkDB
Position
Un
AA seq 144 aa
MKTLLLLAVIMAFGLLQVHGDLTNFWNMIRLKTGKEAASSYGFYGCHCGAGGKGTPKDAT
DRCCAAHDCCYKRLVKRGCGTKFLSYKFSYSKGAIKCAKQGSCKTQLCECDKAAAYCFAK
NKKSYSLKYRYFPNKLCRGSTPRC
NT seq 435 nt   +upstreamnt  +downstreamnt
atgaagaccctcctgctgctggcggtgatcatggcctttggcttgctgcaggtccacggg
gacttgacaaacttctggaacatgatccggttgaagacaggaaaggaagctgcgagcagt
tatggcttctatggttgtcactgcggcgcgggtggcaaaggaacccccaaagacgcaact
gatcggtgctgtgctgcccatgactgctgctacaagcgtctggtgaaacgcggatgtggc
accaagtttctgagctacaagtttagctacagcaagggcgcgatcaaatgcgcaaagcaa
ggctcctgtaagacccagctgtgtgaatgtgataaagccgccgcctactgttttgctaaa
aacaagaagagctatagtctcaagtaccggtacttccccaacaagctgtgcagagggagc
accccccggtgctga

KEGG   Tupaia chinensis (Chinese tree shrew): 102502195
Entry
102502195         CDS       T02978                                 

Gene name
PLA2G2E
Definition
(RefSeq) phospholipase A2 group IIE
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup00564  Glycerophospholipid metabolism
tup00565  Ether lipid metabolism
tup00590  Arachidonic acid metabolism
tup00591  Linoleic acid metabolism
tup00592  alpha-Linolenic acid metabolism
tup01100  Metabolic pathways
tup04014  Ras signaling pathway
tup04270  Vascular smooth muscle contraction
tup04972  Pancreatic secretion
tup04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:tup00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102502195 (PLA2G2E)
   00565 Ether lipid metabolism
    102502195 (PLA2G2E)
   00590 Arachidonic acid metabolism
    102502195 (PLA2G2E)
   00591 Linoleic acid metabolism
    102502195 (PLA2G2E)
   00592 alpha-Linolenic acid metabolism
    102502195 (PLA2G2E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102502195 (PLA2G2E)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102502195 (PLA2G2E)
  09154 Digestive system
   04972 Pancreatic secretion
    102502195 (PLA2G2E)
   04975 Fat digestion and absorption
    102502195 (PLA2G2E)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tup03036]
    102502195 (PLA2G2E)
Enzymes [BR:tup01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     102502195 (PLA2G2E)
Chromosome and associated proteins [BR:tup03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    102502195 (PLA2G2E)
SSDB
Motif
Pfam: Phospholip_A2_1
Other DBs
NCBI-GeneID: 102502195
NCBI-ProteinID: XP_006145262
LinkDB
Position
Un
AA seq 142 aa
MKPPPVLTLLCILVALAGGNLVQFGVMIERMTGKPALQYNDYGCYCGIGGSHWPVDQTDW
CCHAHDCCYGRLEKLGCEPKLEKYLFSVGKDNIFCAGRTTCQRQTCECDRRAALCFRRHL
GTYNRKYAHYPNKLCTGPTPPC
NT seq 429 nt   +upstreamnt  +downstreamnt
atgaaacctccccctgttctgactttgctttgcatcctggtggccctggccggcgggaac
ctggtgcagttcggggtgatgatcgagcggatgacggggaagccagccctgcagtacaac
gactacggctgctactgcggcatcggtggctcccactggccggtggaccagaccgactgg
tgctgccacgcccacgactgctgctatgggcggctggagaagctaggctgtgagcccaaa
ctggagaagtacctcttctctgtcggcaaggacaacatcttctgtgccggcagaaccacc
tgccagaggcagacctgcgagtgcgaccggagggctgcactctgcttccgccgccacctg
ggcacctacaaccgcaagtacgcccactaccccaacaagctgtgcaccgggccaaccccg
ccctgctga

DBGET integrated database retrieval system