KEGG   Tupaia chinensis (Chinese tree shrew): 102476020
Entry
102476020         CDS       T02978                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin 3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04060  Cytokine-cytokine receptor interaction
tup04151  PI3K-Akt signaling pathway
tup04210  Apoptosis
tup04630  JAK-STAT signaling pathway
tup04640  Hematopoietic cell lineage
tup05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102476020 (IL3RA)
   04151 PI3K-Akt signaling pathway
    102476020 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102476020 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102476020 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102476020 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102476020 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:tup04050]
    102476020 (IL3RA)
   04090 CD molecules [BR:tup04090]
    102476020 (IL3RA)
Cytokine receptors [BR:tup04050]
 Interleukin receptor families
  IL3 receptor family
   102476020 (IL3RA)
CD molecules [BR:tup04090]
 Proteins
  102476020 (IL3RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind Tissue_fac
Other DBs
NCBI-GeneID: 102476020
NCBI-ProteinID: XP_006164587
LinkDB
Position
Un
AA seq 377 aa
MGPDHEDPNAPIRNLRVEPGTRKVTWDRHADVTGVQCRRNGRDTKSATNNNYCVYNTLSL
CNTANYTVSAASPPFSTWVLFPEPARNPGAAARNLNCRIHDVDFLTCTWAVGAEAPRDVQ
YHLHLKDYETGREVSCASYQVDSRGTHVGCRWARIATAFGSSESFLFLVNGTAGRDRVPC
TDMFAALEDIEILSPPNITTQCNATHAFMQWSKPSHYHDKFTYDLRIKKSTGATINETLY
DVSNFRLLNPGSYSVSIRAQEVFVKSQSAWSAPQHFECDPEEGEQTRTWRLSLLIALGTL
LAAVCTLILCKRSTLRQKIFPPIPHMKNHLGESFHNKLMVWEAGGADLEDCPVTEVHETF
RPGELCLSLTGQEPAPR
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggggccagaccacgaagacccaaatgcgcccatcaggaacctgagggtggagccagga
actaggaaggtgacctgggaccgccatgcagacgtgacgggtgtccagtgtagaagaaat
ggccgtgacacaaagtctgccacgaacaacaactactgcgtttacaatactctgtccctg
tgcaacaccgccaactacaccgtcagcgccgccagcccgcccttctccacctgggtcctg
ttccccgagccagcccgcaaccccggggcagcggcccgcaacctgaactgcaggatccac
gacgtggatttcctgacctgcacttgggccgtgggcgcggaggccccccgggacgtgcag
taccacctccacctgaaggactatgagaccggccgggaggtgagctgcgccagctaccag
gtggacagccgcggcacgcacgtggggtgtcgctgggctcgcatcgccacggcgttcggc
agctccgagtccttcctgttcctggtcaacgggaccgccgggcgcgacagggtcccctgc
accgacatgttcgcggccctcgaagacatcgagatcttaagccctccgaacatcacgact
cagtgtaacgcgacacacgctttcatgcagtggagtaagcccagtcactaccacgacaaa
ttcacgtacgaccttcggattaaaaagagcacaggagccaccatcaacgaaacgctctac
gacgtcagcaacttcaggctgctcaaccccgggtcgtactccgtgagcatcagggcgcag
gaggtgtttgtcaagagccagagcgcgtggagcgccccccagcactttgagtgcgacccg
gaggagggcgagcagacgcgcacatggcggctgtctctgctcatcgcgctggggacgctg
ctggccgcggtgtgcacgctgatcctctgcaaacggtccacgctgaggcagaagatcttt
ccccccatcccgcacatgaagaaccacctcggcgaaagcttccacaacaagctgatggtc
tgggaggctggcggagcagacctggaggactgcccggtgacggaggtgcacgaaaccttt
cgccctggagagctgtgcctctccctgacgggccaggaaccagctccccggtga

DBGET integrated database retrieval system