KEGG   Tupaia chinensis (Chinese tree shrew): 102476038
Entry
102476038         CDS       T02978                                 

Gene name
GSK3B
Definition
(RefSeq) glycogen synthase kinase 3 beta
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01521  EGFR tyrosine kinase inhibitor resistance
tup04012  ErbB signaling pathway
tup04062  Chemokine signaling pathway
tup04110  Cell cycle
tup04150  mTOR signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04310  Wnt signaling pathway
tup04340  Hedgehog signaling pathway
tup04360  Axon guidance
tup04390  Hippo signaling pathway
tup04510  Focal adhesion
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04657  IL-17 signaling pathway
tup04660  T cell receptor signaling pathway
tup04662  B cell receptor signaling pathway
tup04722  Neurotrophin signaling pathway
tup04728  Dopaminergic synapse
tup04910  Insulin signaling pathway
tup04916  Melanogenesis
tup04917  Prolactin signaling pathway
tup04919  Thyroid hormone signaling pathway
tup04931  Insulin resistance
tup04932  Non-alcoholic fatty liver disease
tup04934  Cushing syndrome
tup04935  Growth hormone synthesis, secretion and action
tup05010  Alzheimer disease
tup05020  Prion disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05135  Yersinia infection
tup05160  Hepatitis C
tup05162  Measles
tup05163  Human cytomegalovirus infection
tup05165  Human papillomavirus infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05200  Pathways in cancer
tup05210  Colorectal cancer
tup05213  Endometrial cancer
tup05215  Prostate cancer
tup05217  Basal cell carcinoma
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102476038 (GSK3B)
   04310 Wnt signaling pathway
    102476038 (GSK3B)
   04340 Hedgehog signaling pathway
    102476038 (GSK3B)
   04390 Hippo signaling pathway
    102476038 (GSK3B)
   04151 PI3K-Akt signaling pathway
    102476038 (GSK3B)
   04150 mTOR signaling pathway
    102476038 (GSK3B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102476038 (GSK3B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102476038 (GSK3B)
   04550 Signaling pathways regulating pluripotency of stem cells
    102476038 (GSK3B)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    102476038 (GSK3B)
   04657 IL-17 signaling pathway
    102476038 (GSK3B)
   04662 B cell receptor signaling pathway
    102476038 (GSK3B)
   04062 Chemokine signaling pathway
    102476038 (GSK3B)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102476038 (GSK3B)
   04917 Prolactin signaling pathway
    102476038 (GSK3B)
   04935 Growth hormone synthesis, secretion and action
    102476038 (GSK3B)
   04919 Thyroid hormone signaling pathway
    102476038 (GSK3B)
   04916 Melanogenesis
    102476038 (GSK3B)
  09156 Nervous system
   04728 Dopaminergic synapse
    102476038 (GSK3B)
   04722 Neurotrophin signaling pathway
    102476038 (GSK3B)
  09158 Development and regeneration
   04360 Axon guidance
    102476038 (GSK3B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102476038 (GSK3B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102476038 (GSK3B)
   05225 Hepatocellular carcinoma
    102476038 (GSK3B)
   05226 Gastric cancer
    102476038 (GSK3B)
   05217 Basal cell carcinoma
    102476038 (GSK3B)
   05215 Prostate cancer
    102476038 (GSK3B)
   05213 Endometrial cancer
    102476038 (GSK3B)
   05224 Breast cancer
    102476038 (GSK3B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102476038 (GSK3B)
   05020 Prion disease
    102476038 (GSK3B)
   05022 Pathways of neurodegeneration - multiple diseases
    102476038 (GSK3B)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102476038 (GSK3B)
   04931 Insulin resistance
    102476038 (GSK3B)
   04934 Cushing syndrome
    102476038 (GSK3B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102476038 (GSK3B)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102476038 (GSK3B)
   05162 Measles
    102476038 (GSK3B)
   05163 Human cytomegalovirus infection
    102476038 (GSK3B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102476038 (GSK3B)
   05165 Human papillomavirus infection
    102476038 (GSK3B)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102476038 (GSK3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tup01001]
    102476038 (GSK3B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tup03036]
    102476038 (GSK3B)
Enzymes [BR:tup01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     102476038 (GSK3B)
Protein kinases [BR:tup01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   102476038 (GSK3B)
Chromosome and associated proteins [BR:tup03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    102476038 (GSK3B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1 Choline_kinase
Other DBs
NCBI-GeneID: 102476038
NCBI-ProteinID: XP_006166045
LinkDB
Position
Un
AA seq 490 aa
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPN
VKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASGCYSIAHAL
SGDFGLQMLMLEIVGRPTMPLLHQLPIPPEKPRAASCTGETTGYLSVAQQHWSRLERKLK
REKRNKTCSF
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgtcagggcggcccagaaccacctcctttgcggagagctgcaagccagtgcagcagcct
tcagcgtttggcagcatgaaagttagcagagacaaggatggcagcaaggtgaccacagtg
gtggcaactcctgggcagggtccagacaggccacaagaagtcagctatacagacactaaa
gtgattggaaatgggtcgtttggtgtggtttatcaagccaaactttgtgattcaggagaa
ctggttgccatcaagaaagtattacaggacaagagatttaagaaccgagagctgcagatc
atgagaaagctagatcactgtaacatagtccgattgcgttatttcttctactcaagtggt
gagaagaaagatgaagtctatcttaatctggtgctggactatgttccggaaacagtatac
agagttgccagacactacagtcgagccaaacagacgctccctgtgatctatgtcaagttg
tatatgtatcagctgtttcgaagtttagcctatatccattcctttggaatctgccatcgg
gatattaaaccacagaacctcttgttggatcctgatacagctgtcttaaaactctgtgac
tttggaagtgcaaagcagctggtccgaggagaacccaacgtttcgtatatctgttctcgg
tactatagggcgccagagttgatctttggagccactgattatacctctagtatagacgta
tggtctgcaggatgtgtattggctgagctattactaggacaaccaatatttccaggggac
agtggtgtggatcaattggtggaaataatcaaggtcctgggaacaccaacaagggagcaa
attagagaaatgaacccaaactacacagaattcaaattcccacaaattaaggcacatcct
tggactaaggattcgtcaggaacaggacatttcacctcaggagtgcgggtcttccgacct
cgaactccaccagaggcaattgcactgtgtagccgtctgctggaatatacaccaactgcc
cgattgacgccactggaagcttgtgcgcattcattttttgatgaattacgggacccaaat
gtcaaactaccaaatgggcgagatacacctgcactcttcaacttcaccactcaagaactg
tcaagtaatccacctctggctaccatccttattcctcctcatgctcggattcaagcagct
gcttccacccctacaaatgccacagcagcctcagggtgttacagcatcgctcatgctctc
tctggggattttggattgcagatgctaatgctggagatcgtgggcagaccaacaatgccg
cttctgcatcagcttccaattccacctgaaaagccccgagcagccagctgcacaggagaa
accaccggttacttgagtgtcgctcagcaacactggtcacgtttggaaagaaaattaaaa
agagaaaaaagaaacaaaacctgttcattttag

DBGET integrated database retrieval system