KEGG   Tupaia chinensis (Chinese tree shrew): 102476496
Entry
102476496         CDS       T02978                                 

Gene name
MAP2K1
Definition
(RefSeq) mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01521  EGFR tyrosine kinase inhibitor resistance
tup01522  Endocrine resistance
tup04010  MAPK signaling pathway
tup04012  ErbB signaling pathway
tup04014  Ras signaling pathway
tup04015  Rap1 signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04024  cAMP signaling pathway
tup04062  Chemokine signaling pathway
tup04066  HIF-1 signaling pathway
tup04068  FoxO signaling pathway
tup04071  Sphingolipid signaling pathway
tup04072  Phospholipase D signaling pathway
tup04114  Oocyte meiosis
tup04140  Autophagy - animal
tup04150  mTOR signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04210  Apoptosis
tup04218  Cellular senescence
tup04270  Vascular smooth muscle contraction
tup04370  VEGF signaling pathway
tup04371  Apelin signaling pathway
tup04380  Osteoclast differentiation
tup04510  Focal adhesion
tup04540  Gap junction
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04613  Neutrophil extracellular trap formation
tup04620  Toll-like receptor signaling pathway
tup04650  Natural killer cell mediated cytotoxicity
tup04660  T cell receptor signaling pathway
tup04662  B cell receptor signaling pathway
tup04664  Fc epsilon RI signaling pathway
tup04666  Fc gamma R-mediated phagocytosis
tup04668  TNF signaling pathway
tup04720  Long-term potentiation
tup04722  Neurotrophin signaling pathway
tup04725  Cholinergic synapse
tup04726  Serotonergic synapse
tup04730  Long-term depression
tup04810  Regulation of actin cytoskeleton
tup04910  Insulin signaling pathway
tup04912  GnRH signaling pathway
tup04914  Progesterone-mediated oocyte maturation
tup04915  Estrogen signaling pathway
tup04916  Melanogenesis
tup04917  Prolactin signaling pathway
tup04919  Thyroid hormone signaling pathway
tup04921  Oxytocin signaling pathway
tup04926  Relaxin signaling pathway
tup04928  Parathyroid hormone synthesis, secretion and action
tup04929  GnRH secretion
tup04934  Cushing syndrome
tup04935  Growth hormone synthesis, secretion and action
tup05010  Alzheimer disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05034  Alcoholism
tup05132  Salmonella infection
tup05135  Yersinia infection
tup05160  Hepatitis C
tup05161  Hepatitis B
tup05163  Human cytomegalovirus infection
tup05164  Influenza A
tup05165  Human papillomavirus infection
tup05166  Human T-cell leukemia virus 1 infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05170  Human immunodeficiency virus 1 infection
tup05200  Pathways in cancer
tup05205  Proteoglycans in cancer
tup05206  MicroRNAs in cancer
tup05210  Colorectal cancer
tup05211  Renal cell carcinoma
tup05212  Pancreatic cancer
tup05213  Endometrial cancer
tup05214  Glioma
tup05215  Prostate cancer
tup05216  Thyroid cancer
tup05218  Melanoma
tup05219  Bladder cancer
tup05220  Chronic myeloid leukemia
tup05221  Acute myeloid leukemia
tup05223  Non-small cell lung cancer
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
tup05230  Central carbon metabolism in cancer
tup05231  Choline metabolism in cancer
tup05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102476496 (MAP2K1)
   04012 ErbB signaling pathway
    102476496 (MAP2K1)
   04014 Ras signaling pathway
    102476496 (MAP2K1)
   04015 Rap1 signaling pathway
    102476496 (MAP2K1)
   04370 VEGF signaling pathway
    102476496 (MAP2K1)
   04371 Apelin signaling pathway
    102476496 (MAP2K1)
   04668 TNF signaling pathway
    102476496 (MAP2K1)
   04066 HIF-1 signaling pathway
    102476496 (MAP2K1)
   04068 FoxO signaling pathway
    102476496 (MAP2K1)
   04072 Phospholipase D signaling pathway
    102476496 (MAP2K1)
   04071 Sphingolipid signaling pathway
    102476496 (MAP2K1)
   04024 cAMP signaling pathway
    102476496 (MAP2K1)
   04022 cGMP-PKG signaling pathway
    102476496 (MAP2K1)
   04151 PI3K-Akt signaling pathway
    102476496 (MAP2K1)
   04150 mTOR signaling pathway
    102476496 (MAP2K1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102476496 (MAP2K1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102476496 (MAP2K1)
   04210 Apoptosis
    102476496 (MAP2K1)
   04218 Cellular senescence
    102476496 (MAP2K1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102476496 (MAP2K1)
   04540 Gap junction
    102476496 (MAP2K1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102476496 (MAP2K1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102476496 (MAP2K1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102476496 (MAP2K1)
   04620 Toll-like receptor signaling pathway
    102476496 (MAP2K1)
   04650 Natural killer cell mediated cytotoxicity
    102476496 (MAP2K1)
   04660 T cell receptor signaling pathway
    102476496 (MAP2K1)
   04662 B cell receptor signaling pathway
    102476496 (MAP2K1)
   04664 Fc epsilon RI signaling pathway
    102476496 (MAP2K1)
   04666 Fc gamma R-mediated phagocytosis
    102476496 (MAP2K1)
   04062 Chemokine signaling pathway
    102476496 (MAP2K1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102476496 (MAP2K1)
   04929 GnRH secretion
    102476496 (MAP2K1)
   04912 GnRH signaling pathway
    102476496 (MAP2K1)
   04915 Estrogen signaling pathway
    102476496 (MAP2K1)
   04914 Progesterone-mediated oocyte maturation
    102476496 (MAP2K1)
   04917 Prolactin signaling pathway
    102476496 (MAP2K1)
   04921 Oxytocin signaling pathway
    102476496 (MAP2K1)
   04926 Relaxin signaling pathway
    102476496 (MAP2K1)
   04935 Growth hormone synthesis, secretion and action
    102476496 (MAP2K1)
   04919 Thyroid hormone signaling pathway
    102476496 (MAP2K1)
   04928 Parathyroid hormone synthesis, secretion and action
    102476496 (MAP2K1)
   04916 Melanogenesis
    102476496 (MAP2K1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102476496 (MAP2K1)
  09156 Nervous system
   04725 Cholinergic synapse
    102476496 (MAP2K1)
   04726 Serotonergic synapse
    102476496 (MAP2K1)
   04720 Long-term potentiation
    102476496 (MAP2K1)
   04730 Long-term depression
    102476496 (MAP2K1)
   04722 Neurotrophin signaling pathway
    102476496 (MAP2K1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102476496 (MAP2K1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102476496 (MAP2K1)
   05206 MicroRNAs in cancer
    102476496 (MAP2K1)
   05205 Proteoglycans in cancer
    102476496 (MAP2K1)
   05230 Central carbon metabolism in cancer
    102476496 (MAP2K1)
   05231 Choline metabolism in cancer
    102476496 (MAP2K1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102476496 (MAP2K1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102476496 (MAP2K1)
   05212 Pancreatic cancer
    102476496 (MAP2K1)
   05225 Hepatocellular carcinoma
    102476496 (MAP2K1)
   05226 Gastric cancer
    102476496 (MAP2K1)
   05214 Glioma
    102476496 (MAP2K1)
   05216 Thyroid cancer
    102476496 (MAP2K1)
   05221 Acute myeloid leukemia
    102476496 (MAP2K1)
   05220 Chronic myeloid leukemia
    102476496 (MAP2K1)
   05218 Melanoma
    102476496 (MAP2K1)
   05211 Renal cell carcinoma
    102476496 (MAP2K1)
   05219 Bladder cancer
    102476496 (MAP2K1)
   05215 Prostate cancer
    102476496 (MAP2K1)
   05213 Endometrial cancer
    102476496 (MAP2K1)
   05224 Breast cancer
    102476496 (MAP2K1)
   05223 Non-small cell lung cancer
    102476496 (MAP2K1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102476496 (MAP2K1)
   05022 Pathways of neurodegeneration - multiple diseases
    102476496 (MAP2K1)
  09165 Substance dependence
   05034 Alcoholism
    102476496 (MAP2K1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102476496 (MAP2K1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102476496 (MAP2K1)
   05135 Yersinia infection
    102476496 (MAP2K1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102476496 (MAP2K1)
   05170 Human immunodeficiency virus 1 infection
    102476496 (MAP2K1)
   05161 Hepatitis B
    102476496 (MAP2K1)
   05160 Hepatitis C
    102476496 (MAP2K1)
   05164 Influenza A
    102476496 (MAP2K1)
   05163 Human cytomegalovirus infection
    102476496 (MAP2K1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102476496 (MAP2K1)
   05165 Human papillomavirus infection
    102476496 (MAP2K1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102476496 (MAP2K1)
   01522 Endocrine resistance
    102476496 (MAP2K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tup01001]
    102476496 (MAP2K1)
Enzymes [BR:tup01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     102476496 (MAP2K1)
Protein kinases [BR:tup01001]
 Serine/threonine kinases: STE group
  STE7 family
   102476496 (MAP2K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Seadorna_VP7 Kinase-like NAD_binding_6
Other DBs
NCBI-GeneID: 102476496
NCBI-ProteinID: XP_006153550
LinkDB
Position
Un
AA seq 371 aa
MELERTNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVV
FKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISIC
MEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRG
EIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAIGRYP
IPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSYGMDNRPPMAIFELLDYIVNEPP
PKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLN
QPSTPTHVAGV
NT seq 1116 nt   +upstreamnt  +downstreamnt
atggagctggagaggaccaacctggaggccttgcagaagaagctggaggagctggaactg
gacgaacagcagcggaagcgcctagaggcctttctcacccagaagcagaaggtgggagaa
ctgaaggatgacgacttcgagaagatcagtgagctgggcgcaggcaacggtggtgtggtg
ttcaaggtctcccacaagccatccggcctggtcatggccaggaagctaatccacctggag
atcaagccggccatccggaaccagatcatcagggagctgcaggttctgcacgagtgcaac
tccccgtacatcgtgggcttctacggagccttctacagcgacggcgagatcagcatctgc
atggagcacatggatgggggttccttggatcaagttctcaagaaagctggaagaattcct
gagcaaatcttaggaaaagttagcattgctgtgataaaaggcctgacttatctgagggag
aagcacaagattatgcacagagatgtcaagccgtccaacatcctcgtcaactcccgtggg
gagatcaagctttgtgactttggggtcagcggacagctcatcgactccatggccaactcc
tttgtgggcacaaggtcctacatgtcgccagaaagactccagggcactcactactcggtg
cagtcggacatctggagcatggggctgtccctggtggagatggcgattgggaggtatccc
atccctcctccagatgccaaggagctggagctgatgtttggatgccaggtggagggagat
gcagctgagacacctcccaggccgaggacccccggaaggcccctcagctcgtacgggatg
gacaaccgacctccgatggcgatttttgaattgttggattacatagtcaatgagcctcct
ccaaagctgcccagtggagtgttcagcctggaatttcaggatttcgtgaataaatgcttg
ataaaaaaccccgcggagagagcagatctgaagcaactcatggttcatgcttttatcaag
agatctgacgctgaagaagtggattttgcaggttggctctgctccaccatcggccttaac
cagcccagcacaccgactcatgtggctggggtctga

KEGG   Tupaia chinensis (Chinese tree shrew): 102483700
Entry
102483700         CDS       T02978                                 

Gene name
MAP2K2
Definition
(RefSeq) mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01521  EGFR tyrosine kinase inhibitor resistance
tup01522  Endocrine resistance
tup04010  MAPK signaling pathway
tup04012  ErbB signaling pathway
tup04014  Ras signaling pathway
tup04015  Rap1 signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04024  cAMP signaling pathway
tup04066  HIF-1 signaling pathway
tup04068  FoxO signaling pathway
tup04071  Sphingolipid signaling pathway
tup04072  Phospholipase D signaling pathway
tup04140  Autophagy - animal
tup04150  mTOR signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04210  Apoptosis
tup04218  Cellular senescence
tup04270  Vascular smooth muscle contraction
tup04370  VEGF signaling pathway
tup04371  Apelin signaling pathway
tup04540  Gap junction
tup04550  Signaling pathways regulating pluripotency of stem cells
tup04613  Neutrophil extracellular trap formation
tup04620  Toll-like receptor signaling pathway
tup04650  Natural killer cell mediated cytotoxicity
tup04660  T cell receptor signaling pathway
tup04662  B cell receptor signaling pathway
tup04664  Fc epsilon RI signaling pathway
tup04720  Long-term potentiation
tup04722  Neurotrophin signaling pathway
tup04730  Long-term depression
tup04810  Regulation of actin cytoskeleton
tup04910  Insulin signaling pathway
tup04912  GnRH signaling pathway
tup04915  Estrogen signaling pathway
tup04916  Melanogenesis
tup04917  Prolactin signaling pathway
tup04919  Thyroid hormone signaling pathway
tup04921  Oxytocin signaling pathway
tup04926  Relaxin signaling pathway
tup04929  GnRH secretion
tup04934  Cushing syndrome
tup04935  Growth hormone synthesis, secretion and action
tup05010  Alzheimer disease
tup05022  Pathways of neurodegeneration - multiple diseases
tup05132  Salmonella infection
tup05135  Yersinia infection
tup05160  Hepatitis C
tup05161  Hepatitis B
tup05163  Human cytomegalovirus infection
tup05164  Influenza A
tup05165  Human papillomavirus infection
tup05166  Human T-cell leukemia virus 1 infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05170  Human immunodeficiency virus 1 infection
tup05200  Pathways in cancer
tup05205  Proteoglycans in cancer
tup05206  MicroRNAs in cancer
tup05210  Colorectal cancer
tup05211  Renal cell carcinoma
tup05213  Endometrial cancer
tup05214  Glioma
tup05215  Prostate cancer
tup05216  Thyroid cancer
tup05218  Melanoma
tup05219  Bladder cancer
tup05220  Chronic myeloid leukemia
tup05221  Acute myeloid leukemia
tup05223  Non-small cell lung cancer
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
tup05230  Central carbon metabolism in cancer
tup05231  Choline metabolism in cancer
tup05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102483700 (MAP2K2)
   04012 ErbB signaling pathway
    102483700 (MAP2K2)
   04014 Ras signaling pathway
    102483700 (MAP2K2)
   04015 Rap1 signaling pathway
    102483700 (MAP2K2)
   04370 VEGF signaling pathway
    102483700 (MAP2K2)
   04371 Apelin signaling pathway
    102483700 (MAP2K2)
   04066 HIF-1 signaling pathway
    102483700 (MAP2K2)
   04068 FoxO signaling pathway
    102483700 (MAP2K2)
   04072 Phospholipase D signaling pathway
    102483700 (MAP2K2)
   04071 Sphingolipid signaling pathway
    102483700 (MAP2K2)
   04024 cAMP signaling pathway
    102483700 (MAP2K2)
   04022 cGMP-PKG signaling pathway
    102483700 (MAP2K2)
   04151 PI3K-Akt signaling pathway
    102483700 (MAP2K2)
   04150 mTOR signaling pathway
    102483700 (MAP2K2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102483700 (MAP2K2)
  09143 Cell growth and death
   04210 Apoptosis
    102483700 (MAP2K2)
   04218 Cellular senescence
    102483700 (MAP2K2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102483700 (MAP2K2)
   04550 Signaling pathways regulating pluripotency of stem cells
    102483700 (MAP2K2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102483700 (MAP2K2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102483700 (MAP2K2)
   04620 Toll-like receptor signaling pathway
    102483700 (MAP2K2)
   04650 Natural killer cell mediated cytotoxicity
    102483700 (MAP2K2)
   04660 T cell receptor signaling pathway
    102483700 (MAP2K2)
   04662 B cell receptor signaling pathway
    102483700 (MAP2K2)
   04664 Fc epsilon RI signaling pathway
    102483700 (MAP2K2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102483700 (MAP2K2)
   04929 GnRH secretion
    102483700 (MAP2K2)
   04912 GnRH signaling pathway
    102483700 (MAP2K2)
   04915 Estrogen signaling pathway
    102483700 (MAP2K2)
   04917 Prolactin signaling pathway
    102483700 (MAP2K2)
   04921 Oxytocin signaling pathway
    102483700 (MAP2K2)
   04926 Relaxin signaling pathway
    102483700 (MAP2K2)
   04935 Growth hormone synthesis, secretion and action
    102483700 (MAP2K2)
   04919 Thyroid hormone signaling pathway
    102483700 (MAP2K2)
   04916 Melanogenesis
    102483700 (MAP2K2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102483700 (MAP2K2)
  09156 Nervous system
   04720 Long-term potentiation
    102483700 (MAP2K2)
   04730 Long-term depression
    102483700 (MAP2K2)
   04722 Neurotrophin signaling pathway
    102483700 (MAP2K2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102483700 (MAP2K2)
   05206 MicroRNAs in cancer
    102483700 (MAP2K2)
   05205 Proteoglycans in cancer
    102483700 (MAP2K2)
   05230 Central carbon metabolism in cancer
    102483700 (MAP2K2)
   05231 Choline metabolism in cancer
    102483700 (MAP2K2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102483700 (MAP2K2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102483700 (MAP2K2)
   05225 Hepatocellular carcinoma
    102483700 (MAP2K2)
   05226 Gastric cancer
    102483700 (MAP2K2)
   05214 Glioma
    102483700 (MAP2K2)
   05216 Thyroid cancer
    102483700 (MAP2K2)
   05221 Acute myeloid leukemia
    102483700 (MAP2K2)
   05220 Chronic myeloid leukemia
    102483700 (MAP2K2)
   05218 Melanoma
    102483700 (MAP2K2)
   05211 Renal cell carcinoma
    102483700 (MAP2K2)
   05219 Bladder cancer
    102483700 (MAP2K2)
   05215 Prostate cancer
    102483700 (MAP2K2)
   05213 Endometrial cancer
    102483700 (MAP2K2)
   05224 Breast cancer
    102483700 (MAP2K2)
   05223 Non-small cell lung cancer
    102483700 (MAP2K2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102483700 (MAP2K2)
   05022 Pathways of neurodegeneration - multiple diseases
    102483700 (MAP2K2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102483700 (MAP2K2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102483700 (MAP2K2)
   05135 Yersinia infection
    102483700 (MAP2K2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102483700 (MAP2K2)
   05170 Human immunodeficiency virus 1 infection
    102483700 (MAP2K2)
   05161 Hepatitis B
    102483700 (MAP2K2)
   05160 Hepatitis C
    102483700 (MAP2K2)
   05164 Influenza A
    102483700 (MAP2K2)
   05163 Human cytomegalovirus infection
    102483700 (MAP2K2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102483700 (MAP2K2)
   05165 Human papillomavirus infection
    102483700 (MAP2K2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102483700 (MAP2K2)
   01522 Endocrine resistance
    102483700 (MAP2K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tup01001]
    102483700 (MAP2K2)
Enzymes [BR:tup01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     102483700 (MAP2K2)
Protein kinases [BR:tup01001]
 Serine/threonine kinases: STE group
  STE7 family
   102483700 (MAP2K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 102483700
NCBI-ProteinID: XP_014441031
LinkDB
Position
Un
AA seq 400 aa
MLARRKPVLPALTINPALAEGPSPTSEGASEANLVDLQKKLEELDLDEQQRKRLEAFLTQ
KAKVGELKDDDFDRISELGAGNGGVVTKVQHRPSGLIMARKLSHLEIKPAIRNQIIRELQ
VLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRVPEEVLGKVSIAVLRG
LAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQ
GTHYSVQSDIWSMGLSLVELSIGRYPIPPPDAKELEAIFGRPLADGSEAEPHSVSPRPRP
PGRPISGHGMDSRPAMAIFELLDYIVNEPPPKLPNGVFTPDFQEFVNKCLIKNPAERADL
KMLMNHAFIKRSEVEEVDFAGWLCKTLRLSQPGTPTRTAV
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgctggcccggaggaagccggtgctgccggcgctcaccatcaaccccgccctcgccgag
ggcccgtcccccaccagcgagggcgcctccgaggcgaacctggtggacctgcagaagaag
ctagaggagctggacctggacgagcagcagaggaagcggctggaggccttcctcacccag
aaggcgaaggtcggcgagctcaaggacgacgacttcgaccgcatctcggagctgggcgcc
ggcaatggcggcgtggtcaccaaggtgcagcaccggccgtcgggcctcatcatggccagg
aagctgagccacctggagatcaagccggccatccggaaccagatcatccgcgagctgcag
gtgctgcacgagtgcaactccccgtacatcgtgggcttctacggggccttctacagcgac
ggcgagatcagcatctgcatggagcacatggatggcggctccctggaccaggtgctgaag
gaagccaagagggtccccgaggaggtcctgggcaaggtcagcatcgcggtgctccggggc
ttggcctacctccgggaaaagcaccagatcatgcaccgagacgtgaagccctccaacatc
ctggtcaactccaggggggagatcaagctctgtgacttcggggtgagcgggcagctcatc
gactccatggccaactccttcgtggggacgcgctcctacatgtctccagagcgactccag
ggcacgcactactccgtgcagtcagacatctggagcatgggcctgtccctggtggagctg
tccatcgggaggtaccccatccccccgcccgacgccaaagagctggaagccatcttcggc
cggcccctggccgacgggtcggaagcagagccccacagtgtctcgccacggccccgaccg
cccgggcgccccatcagcggtcacggcatggacagccggccggccatggccatcttcgag
ctgctggactacatcgtcaacgagcctcctcccaagctgcccaacggagtgttcacgccg
gactttcaggagtttgtaaataaatgcctcattaagaacccagctgaacgggcggacctg
aagatgctcatgaaccacgccttcatcaagcggtccgaggtggaggaagtggactttgcc
ggctggttgtgtaagaccctgcggctgagccagcccggcacgcccacgcgcacggccgtg
tga

DBGET integrated database retrieval system