KEGG   Tupaia chinensis (Chinese tree shrew): 102476523
Entry
102476523         CDS       T02978                                 

Gene name
GADD45B
Definition
(RefSeq) growth arrest and DNA damage inducible beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04010  MAPK signaling pathway
tup04064  NF-kappa B signaling pathway
tup04068  FoxO signaling pathway
tup04110  Cell cycle
tup04115  p53 signaling pathway
tup04210  Apoptosis
tup04218  Cellular senescence
tup05169  Epstein-Barr virus infection
tup05200  Pathways in cancer
tup05202  Transcriptional misregulation in cancer
tup05210  Colorectal cancer
tup05212  Pancreatic cancer
tup05213  Endometrial cancer
tup05214  Glioma
tup05216  Thyroid cancer
tup05217  Basal cell carcinoma
tup05218  Melanoma
tup05220  Chronic myeloid leukemia
tup05222  Small cell lung cancer
tup05223  Non-small cell lung cancer
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102476523 (GADD45B)
   04064 NF-kappa B signaling pathway
    102476523 (GADD45B)
   04068 FoxO signaling pathway
    102476523 (GADD45B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102476523 (GADD45B)
   04210 Apoptosis
    102476523 (GADD45B)
   04115 p53 signaling pathway
    102476523 (GADD45B)
   04218 Cellular senescence
    102476523 (GADD45B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102476523 (GADD45B)
   05202 Transcriptional misregulation in cancer
    102476523 (GADD45B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102476523 (GADD45B)
   05212 Pancreatic cancer
    102476523 (GADD45B)
   05225 Hepatocellular carcinoma
    102476523 (GADD45B)
   05226 Gastric cancer
    102476523 (GADD45B)
   05214 Glioma
    102476523 (GADD45B)
   05216 Thyroid cancer
    102476523 (GADD45B)
   05220 Chronic myeloid leukemia
    102476523 (GADD45B)
   05217 Basal cell carcinoma
    102476523 (GADD45B)
   05218 Melanoma
    102476523 (GADD45B)
   05213 Endometrial cancer
    102476523 (GADD45B)
   05224 Breast cancer
    102476523 (GADD45B)
   05222 Small cell lung cancer
    102476523 (GADD45B)
   05223 Non-small cell lung cancer
    102476523 (GADD45B)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    102476523 (GADD45B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tup03036]
    102476523 (GADD45B)
Chromosome and associated proteins [BR:tup03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     102476523 (GADD45B)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     102476523 (GADD45B)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 102476523
NCBI-ProteinID: XP_006171840
UniProt: L8Y4F4
LinkDB
Position
Un
AA seq 160 aa
MTLDELVACDNAARKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLA
IDEEEEGDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPEETQGAAEARDLHCL
LVTNPHADGWKSHGLIEVASYCEESRGNNQWVPSIALQER
NT seq 483 nt   +upstreamnt  +downstreamnt
atgactctggacgagctcgtggcgtgcgacaacgcggcgcggaagatgcagacggtgacc
gcggcggtggaggagctcctggtggccgcgcagcgccaggaccgcctcaccgtgggggtg
tacgagtcggccaagctgatgaatgtggaccctgacagcgtggtcctgtgcctcttagcc
attgacgaggaggaggagggcgacatcgccctgcagatccacttcacgctgatccagtct
ttctgctgtgacaacgacatcaacatcgtgcgggtgtcgggcatgcagcgcctggcgcag
ctgctgggggagccggaggagacgcagggcgccgcggaggcccgcgacctgcactgcctc
ctagtcacgaaccctcacgccgacggctggaagagccatggcttgatcgaggtggccagc
tattgcgaggaaagccggggcaacaaccagtgggtcccctccatcgctctccaggaacgc
tga

KEGG   Tupaia chinensis (Chinese tree shrew): 102496861
Entry
102496861         CDS       T02978                                 

Gene name
GADD45G
Definition
(RefSeq) growth arrest and DNA damage inducible gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04010  MAPK signaling pathway
tup04064  NF-kappa B signaling pathway
tup04068  FoxO signaling pathway
tup04110  Cell cycle
tup04115  p53 signaling pathway
tup04210  Apoptosis
tup04218  Cellular senescence
tup05169  Epstein-Barr virus infection
tup05200  Pathways in cancer
tup05202  Transcriptional misregulation in cancer
tup05210  Colorectal cancer
tup05212  Pancreatic cancer
tup05213  Endometrial cancer
tup05214  Glioma
tup05216  Thyroid cancer
tup05217  Basal cell carcinoma
tup05218  Melanoma
tup05220  Chronic myeloid leukemia
tup05222  Small cell lung cancer
tup05223  Non-small cell lung cancer
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102496861 (GADD45G)
   04064 NF-kappa B signaling pathway
    102496861 (GADD45G)
   04068 FoxO signaling pathway
    102496861 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102496861 (GADD45G)
   04210 Apoptosis
    102496861 (GADD45G)
   04115 p53 signaling pathway
    102496861 (GADD45G)
   04218 Cellular senescence
    102496861 (GADD45G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102496861 (GADD45G)
   05202 Transcriptional misregulation in cancer
    102496861 (GADD45G)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102496861 (GADD45G)
   05212 Pancreatic cancer
    102496861 (GADD45G)
   05225 Hepatocellular carcinoma
    102496861 (GADD45G)
   05226 Gastric cancer
    102496861 (GADD45G)
   05214 Glioma
    102496861 (GADD45G)
   05216 Thyroid cancer
    102496861 (GADD45G)
   05220 Chronic myeloid leukemia
    102496861 (GADD45G)
   05217 Basal cell carcinoma
    102496861 (GADD45G)
   05218 Melanoma
    102496861 (GADD45G)
   05213 Endometrial cancer
    102496861 (GADD45G)
   05224 Breast cancer
    102496861 (GADD45G)
   05222 Small cell lung cancer
    102496861 (GADD45G)
   05223 Non-small cell lung cancer
    102496861 (GADD45G)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    102496861 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tup03036]
    102496861 (GADD45G)
Chromosome and associated proteins [BR:tup03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     102496861 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     102496861 (GADD45G)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 102496861
NCBI-ProteinID: XP_006154394
UniProt: L9KGK6
LinkDB
Position
Un
AA seq 159 aa
MTLEEIRGQDTVPESKARMQGAGKALHELLLSAQRQGCLTAGVYESAKVMNVDPDNVTFC
VLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAQGDLHCI
LISNPNEDAWKDPALEKLSLFCEESRRVNDWVPSITLPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactttggaagaaatccgcggccaggacacggttccggaaagcaaggccaggatgcag
ggtgccgggaaagcgctgcacgagctgctgctctccgcgcaacgccagggttgcctcacc
gccggcgtctacgagtcagccaaagtcatgaatgtggaccccgacaacgtcactttttgt
gtgctggcggccgacgaggaggacgaaggcgacatcgcgctgcagatccattttacgctg
atccaggcgttctgttgcgagaatgacatcgacatcgtgcgtgtgggcgacgtgcagcgg
ctggcggcgatcgtgggtgctggcgaggaggcaggcgcgcagggcgacctgcactgcatc
ctcatttcgaaccctaatgaagacgcgtggaaggaccctgccttggagaagctcagcctg
ttctgcgaggagagtcgcagagtcaacgactgggtgcccagtattaccctccccgagtga

KEGG   Tupaia chinensis (Chinese tree shrew): 102502813
Entry
102502813         CDS       T02978                                 

Gene name
GADD45A
Definition
(RefSeq) growth arrest and DNA damage inducible alpha
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04010  MAPK signaling pathway
tup04064  NF-kappa B signaling pathway
tup04068  FoxO signaling pathway
tup04110  Cell cycle
tup04115  p53 signaling pathway
tup04210  Apoptosis
tup04218  Cellular senescence
tup05169  Epstein-Barr virus infection
tup05200  Pathways in cancer
tup05202  Transcriptional misregulation in cancer
tup05210  Colorectal cancer
tup05212  Pancreatic cancer
tup05213  Endometrial cancer
tup05214  Glioma
tup05216  Thyroid cancer
tup05217  Basal cell carcinoma
tup05218  Melanoma
tup05220  Chronic myeloid leukemia
tup05222  Small cell lung cancer
tup05223  Non-small cell lung cancer
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102502813 (GADD45A)
   04064 NF-kappa B signaling pathway
    102502813 (GADD45A)
   04068 FoxO signaling pathway
    102502813 (GADD45A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102502813 (GADD45A)
   04210 Apoptosis
    102502813 (GADD45A)
   04115 p53 signaling pathway
    102502813 (GADD45A)
   04218 Cellular senescence
    102502813 (GADD45A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102502813 (GADD45A)
   05202 Transcriptional misregulation in cancer
    102502813 (GADD45A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102502813 (GADD45A)
   05212 Pancreatic cancer
    102502813 (GADD45A)
   05225 Hepatocellular carcinoma
    102502813 (GADD45A)
   05226 Gastric cancer
    102502813 (GADD45A)
   05214 Glioma
    102502813 (GADD45A)
   05216 Thyroid cancer
    102502813 (GADD45A)
   05220 Chronic myeloid leukemia
    102502813 (GADD45A)
   05217 Basal cell carcinoma
    102502813 (GADD45A)
   05218 Melanoma
    102502813 (GADD45A)
   05213 Endometrial cancer
    102502813 (GADD45A)
   05224 Breast cancer
    102502813 (GADD45A)
   05222 Small cell lung cancer
    102502813 (GADD45A)
   05223 Non-small cell lung cancer
    102502813 (GADD45A)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    102502813 (GADD45A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tup03036]
    102502813 (GADD45A)
Chromosome and associated proteins [BR:tup03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     102502813 (GADD45A)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     102502813 (GADD45A)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 102502813
NCBI-ProteinID: XP_006167219
UniProt: L8YAD1
LinkDB
Position
Un
AA seq 165 aa
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLESDASPAASEGAEQPP
DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 498 nt   +upstreamnt  +downstreamnt
atgactttggaggaattctcggctggagagcagaagaccgaaaggatggataaggtgggg
gatgccctggaggaagtgctcagcaaagccctgagtcagcgcaccatcacggtcggggtg
tacgaggcggccaagctgctgaacgtcgacccggataacgtggtgctgtgcctgctggcc
gccgacgaggacgacgaccgggacgtggccctgcaaatccactttaccctcatccaggcg
ttctgctgcgagaacgacatcaacatcctgcgcgtcagcaacccgggccggctggcggag
ctcctgctcctggagagcgacgcgagcccggcggccagcgagggcgccgagcagcccccg
gacctgcactgcgtgctggtgacgaatccacactcatcacaatggaaggatcctgcctta
agtcagcttatttgtttttgccgggaaagtcgctacatggatcagtgggttccagtgatt
aatcttcctgaacggtga

DBGET integrated database retrieval system