KEGG   Tupaia chinensis (Chinese tree shrew): 102476690
Entry
102476690         CDS       T02978                                 

Gene name
BAK1
Definition
(RefSeq) BCL2 antagonist/killer 1
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01524  Platinum drug resistance
tup04141  Protein processing in endoplasmic reticulum
tup04210  Apoptosis
tup04215  Apoptosis - multiple species
tup05022  Pathways of neurodegeneration - multiple diseases
tup05132  Salmonella infection
tup05160  Hepatitis C
tup05162  Measles
tup05163  Human cytomegalovirus infection
tup05164  Influenza A
tup05165  Human papillomavirus infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05168  Herpes simplex virus 1 infection
tup05169  Epstein-Barr virus infection
tup05170  Human immunodeficiency virus 1 infection
tup05200  Pathways in cancer
tup05202  Transcriptional misregulation in cancer
tup05203  Viral carcinogenesis
tup05206  MicroRNAs in cancer
tup05210  Colorectal cancer
tup05212  Pancreatic cancer
tup05213  Endometrial cancer
tup05214  Glioma
tup05216  Thyroid cancer
tup05217  Basal cell carcinoma
tup05218  Melanoma
tup05220  Chronic myeloid leukemia
tup05222  Small cell lung cancer
tup05223  Non-small cell lung cancer
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102476690 (BAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102476690 (BAK1)
   04215 Apoptosis - multiple species
    102476690 (BAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102476690 (BAK1)
   05202 Transcriptional misregulation in cancer
    102476690 (BAK1)
   05206 MicroRNAs in cancer
    102476690 (BAK1)
   05203 Viral carcinogenesis
    102476690 (BAK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102476690 (BAK1)
   05212 Pancreatic cancer
    102476690 (BAK1)
   05225 Hepatocellular carcinoma
    102476690 (BAK1)
   05226 Gastric cancer
    102476690 (BAK1)
   05214 Glioma
    102476690 (BAK1)
   05216 Thyroid cancer
    102476690 (BAK1)
   05220 Chronic myeloid leukemia
    102476690 (BAK1)
   05217 Basal cell carcinoma
    102476690 (BAK1)
   05218 Melanoma
    102476690 (BAK1)
   05213 Endometrial cancer
    102476690 (BAK1)
   05224 Breast cancer
    102476690 (BAK1)
   05222 Small cell lung cancer
    102476690 (BAK1)
   05223 Non-small cell lung cancer
    102476690 (BAK1)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    102476690 (BAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102476690 (BAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102476690 (BAK1)
   05160 Hepatitis C
    102476690 (BAK1)
   05164 Influenza A
    102476690 (BAK1)
   05162 Measles
    102476690 (BAK1)
   05168 Herpes simplex virus 1 infection
    102476690 (BAK1)
   05163 Human cytomegalovirus infection
    102476690 (BAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102476690 (BAK1)
   05169 Epstein-Barr virus infection
    102476690 (BAK1)
   05165 Human papillomavirus infection
    102476690 (BAK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102476690 (BAK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:tup03029]
    102476690 (BAK1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tup02000]
    102476690 (BAK1)
Mitochondrial biogenesis [BR:tup03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    102476690 (BAK1)
Transporters [BR:tup02000]
 Other transporters
  Pores ion channels [TC:1]
   102476690 (BAK1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 102476690
NCBI-ProteinID: XP_006144279
LinkDB
Position
Un
AA seq 211 aa
MASGQGPGPPRQECGEPAPTSASEEQVARDTEEVFRSYVFYRHRQEQESEEVAAPADPEM
DSLPLEPNSTMGQVGRQLAIIGDDINRRYDSEFQAMLQQLQPTAENAYEYFTKIASSLFE
SGINWGRVVALLGFGYRLALHVYQRGLRGFLGQVARFVADFMLRHCIARWIAQRGGWVAA
LDLGNGPIRNVLMVLGVVLLGQFVVRRFFKS
NT seq 636 nt   +upstreamnt  +downstreamnt
atggcatccgggcagggcccagggcctcccaggcaggagtgtggagagcctgccccgacc
tccgcttctgaggagcaggtagcccgggacacagaggaggttttccgcagctacgttttt
taccgccatcggcaggagcaggagtctgaggaggtggccgcccccgccgacccagagatg
gactccttgcccctagaaccaaatagcaccatggggcaggtgggccggcagctcgccatc
atcggggacgacatcaaccgacgctatgactcggagttccaggccatgctgcagcaactg
cagcccacagcggagaacgcctacgagtacttcaccaagatcgcctccagcctgtttgag
agcggcatcaactggggccgagtggtggcgctcctgggcttcggataccgcctggccctc
cacgtctaccagcgcggcctgaggggcttcctgggccaagtggcccgcttcgtggccgac
ttcatgctgcgccactgcatcgcccggtggatcgcgcagagaggcggctgggtggcagcc
ctggacctgggcaacggccccatcaggaatgtgctgatggttctgggtgtggttctgttg
ggtcagtttgtggtacgaagattcttcaagtcatga

DBGET integrated database retrieval system