KEGG   Tupaia chinensis (Chinese tree shrew): 102476758
Entry
102476758         CDS       T02978                                 

Gene name
IKBKG
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit gamma
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01523  Antifolate resistance
tup04010  MAPK signaling pathway
tup04014  Ras signaling pathway
tup04062  Chemokine signaling pathway
tup04064  NF-kappa B signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04210  Apoptosis
tup04380  Osteoclast differentiation
tup04620  Toll-like receptor signaling pathway
tup04621  NOD-like receptor signaling pathway
tup04622  RIG-I-like receptor signaling pathway
tup04623  Cytosolic DNA-sensing pathway
tup04625  C-type lectin receptor signaling pathway
tup04657  IL-17 signaling pathway
tup04658  Th1 and Th2 cell differentiation
tup04659  Th17 cell differentiation
tup04660  T cell receptor signaling pathway
tup04662  B cell receptor signaling pathway
tup04668  TNF signaling pathway
tup04920  Adipocytokine signaling pathway
tup05132  Salmonella infection
tup05135  Yersinia infection
tup05142  Chagas disease
tup05145  Toxoplasmosis
tup05160  Hepatitis C
tup05161  Hepatitis B
tup05162  Measles
tup05163  Human cytomegalovirus infection
tup05164  Influenza A
tup05165  Human papillomavirus infection
tup05166  Human T-cell leukemia virus 1 infection
tup05167  Kaposi sarcoma-associated herpesvirus infection
tup05168  Herpes simplex virus 1 infection
tup05169  Epstein-Barr virus infection
tup05170  Human immunodeficiency virus 1 infection
tup05200  Pathways in cancer
tup05203  Viral carcinogenesis
tup05212  Pancreatic cancer
tup05215  Prostate cancer
tup05220  Chronic myeloid leukemia
tup05221  Acute myeloid leukemia
tup05222  Small cell lung cancer
tup05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
tup05340  Primary immunodeficiency
tup05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102476758 (IKBKG)
   04014 Ras signaling pathway
    102476758 (IKBKG)
   04064 NF-kappa B signaling pathway
    102476758 (IKBKG)
   04668 TNF signaling pathway
    102476758 (IKBKG)
   04151 PI3K-Akt signaling pathway
    102476758 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102476758 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102476758 (IKBKG)
   04621 NOD-like receptor signaling pathway
    102476758 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    102476758 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    102476758 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    102476758 (IKBKG)
   04660 T cell receptor signaling pathway
    102476758 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    102476758 (IKBKG)
   04659 Th17 cell differentiation
    102476758 (IKBKG)
   04657 IL-17 signaling pathway
    102476758 (IKBKG)
   04662 B cell receptor signaling pathway
    102476758 (IKBKG)
   04062 Chemokine signaling pathway
    102476758 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102476758 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102476758 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102476758 (IKBKG)
   05203 Viral carcinogenesis
    102476758 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102476758 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102476758 (IKBKG)
   05221 Acute myeloid leukemia
    102476758 (IKBKG)
   05220 Chronic myeloid leukemia
    102476758 (IKBKG)
   05215 Prostate cancer
    102476758 (IKBKG)
   05222 Small cell lung cancer
    102476758 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    102476758 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102476758 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102476758 (IKBKG)
   05135 Yersinia infection
    102476758 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102476758 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    102476758 (IKBKG)
   05162 Measles
    102476758 (IKBKG)
   05164 Influenza A
    102476758 (IKBKG)
   05161 Hepatitis B
    102476758 (IKBKG)
   05160 Hepatitis C
    102476758 (IKBKG)
   05168 Herpes simplex virus 1 infection
    102476758 (IKBKG)
   05163 Human cytomegalovirus infection
    102476758 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102476758 (IKBKG)
   05169 Epstein-Barr virus infection
    102476758 (IKBKG)
   05165 Human papillomavirus infection
    102476758 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102476758 (IKBKG)
   05142 Chagas disease
    102476758 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    102476758 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tup01001]
    102476758 (IKBKG)
Protein kinases [BR:tup01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   102476758 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10
Other DBs
NCBI-GeneID: 102476758
NCBI-ProteinID: XP_006167569
LinkDB
Position
Un
AA seq 412 aa
MSRHLLKNLPWDMVQPSGGPATEQDLLGEESSLGKPAMLHLPSEQGIPETLQRCLEENQE
LRDAIRQSNQMLRERCEELLRFQVIQREEKEFLMQKFQEARRLVERLSLEKLDLKRQKEQ
ALQEVEHLKRSQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQALEGRARAASEQ
ARQLESEREALEQQHSVQVDQLRMQNQSVEAALRMERQAASEEKAYHQLFQKPPSHIKSS
LVSSERKRGMQLEDLRQQLQQAEEALVAKQEVIDKLKEEAEQHKTIMETVPVLRAQADIY
KADFQAERQAREKLAEKKEVLLQQLEQLQREYSRLKASCQESARIEDMRKRHVEVSQPPL
PAAPTVHHSFHLALPSQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgagcaggcacctcttgaagaatctgccgtgggacatggtgcagcccagcggtggcccg
gccacagagcaggacttgctgggcgaggagtcctctctggggaagccggccatgctgcat
cttccttccgagcaaggcatacctgagactctccagcgctgcctggaggagaatcaagag
ctccgagatgccatccggcagagcaaccagatgctgcgggagcgctgtgaggagctgctt
cgtttccaggtcatccagcgggaggagaaggagttcctcatgcagaagttccaggaggcc
aggaggctagtggagagactgagcctggagaagcttgacctgaagaggcagaaggaacag
gccctgcaggaggtggaacacctgaagagaagccagcagcagatggccgaggacaaggcc
tcagtgaaagcacaagtgacatccttgctgggggagctccaggagagccagagtcgtctg
gaggctgccaccaaggagcggcaggccttggagggcagggcccgggcagccagcgagcag
gccaggcaactggagagcgagcgggaggcactggagcagcagcacagcgtacaggtcgac
cagctgcgcatgcagaaccagagtgtggaggctgccctgcgcatggagcgccaggccgcc
tcagaggagaaggcctatcaccagctcttccagaaaccccccagccacatcaagagcagc
ctggtgagcagtgagcggaagcggggcatgcagcttgaggacctcaggcaacagctgcag
caggctgaggaggccctggtggccaagcaagaagtgatcgacaagctgaaggaggaggct
gagcagcataagactatcatggagactgtcccagttctgagggctcaggctgatatctat
aaggcagacttccaggctgagaggcaggcccgggagaagctggctgagaagaaggaggtc
ttgctgcagcagttggagcagctgcagagggagtatagcagactgaaggccagctgccag
gagtcagcccggattgaggatatgaggaagcggcatgtggaggtctcccagcccccctta
cctgccgcccctacagttcaccactccttccacctggccctgcccagccagcggagaagc
cctcctgaggagccgcctgacttctgctgtcccaagtgccagtatcaagctccagacatg
gacaccctgcagatacatgtcatggagtgcattgagtag

DBGET integrated database retrieval system