KEGG   Tupaia chinensis (Chinese tree shrew): 102477222
Entry
102477222         CDS       T02978                                 

Gene name
SOS2
Definition
(RefSeq) SOS Ras/Rho guanine nucleotide exchange factor 2
  KO
K03099  son of sevenless
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01521  EGFR tyrosine kinase inhibitor resistance
tup01522  Endocrine resistance
tup04010  MAPK signaling pathway
tup04012  ErbB signaling pathway
tup04014  Ras signaling pathway
tup04062  Chemokine signaling pathway
tup04068  FoxO signaling pathway
tup04072  Phospholipase D signaling pathway
tup04150  mTOR signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04510  Focal adhesion
tup04540  Gap junction
tup04630  JAK-STAT signaling pathway
tup04650  Natural killer cell mediated cytotoxicity
tup04660  T cell receptor signaling pathway
tup04662  B cell receptor signaling pathway
tup04664  Fc epsilon RI signaling pathway
tup04714  Thermogenesis
tup04722  Neurotrophin signaling pathway
tup04810  Regulation of actin cytoskeleton
tup04910  Insulin signaling pathway
tup04912  GnRH signaling pathway
tup04915  Estrogen signaling pathway
tup04917  Prolactin signaling pathway
tup04926  Relaxin signaling pathway
tup04935  Growth hormone synthesis, secretion and action
tup05034  Alcoholism
tup05160  Hepatitis C
tup05161  Hepatitis B
tup05163  Human cytomegalovirus infection
tup05165  Human papillomavirus infection
tup05200  Pathways in cancer
tup05205  Proteoglycans in cancer
tup05206  MicroRNAs in cancer
tup05210  Colorectal cancer
tup05211  Renal cell carcinoma
tup05213  Endometrial cancer
tup05214  Glioma
tup05215  Prostate cancer
tup05220  Chronic myeloid leukemia
tup05221  Acute myeloid leukemia
tup05223  Non-small cell lung cancer
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
tup05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102477222 (SOS2)
   04012 ErbB signaling pathway
    102477222 (SOS2)
   04014 Ras signaling pathway
    102477222 (SOS2)
   04630 JAK-STAT signaling pathway
    102477222 (SOS2)
   04068 FoxO signaling pathway
    102477222 (SOS2)
   04072 Phospholipase D signaling pathway
    102477222 (SOS2)
   04151 PI3K-Akt signaling pathway
    102477222 (SOS2)
   04150 mTOR signaling pathway
    102477222 (SOS2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102477222 (SOS2)
   04540 Gap junction
    102477222 (SOS2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102477222 (SOS2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102477222 (SOS2)
   04660 T cell receptor signaling pathway
    102477222 (SOS2)
   04662 B cell receptor signaling pathway
    102477222 (SOS2)
   04664 Fc epsilon RI signaling pathway
    102477222 (SOS2)
   04062 Chemokine signaling pathway
    102477222 (SOS2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102477222 (SOS2)
   04912 GnRH signaling pathway
    102477222 (SOS2)
   04915 Estrogen signaling pathway
    102477222 (SOS2)
   04917 Prolactin signaling pathway
    102477222 (SOS2)
   04926 Relaxin signaling pathway
    102477222 (SOS2)
   04935 Growth hormone synthesis, secretion and action
    102477222 (SOS2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102477222 (SOS2)
  09159 Environmental adaptation
   04714 Thermogenesis
    102477222 (SOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102477222 (SOS2)
   05206 MicroRNAs in cancer
    102477222 (SOS2)
   05205 Proteoglycans in cancer
    102477222 (SOS2)
   05231 Choline metabolism in cancer
    102477222 (SOS2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102477222 (SOS2)
   05225 Hepatocellular carcinoma
    102477222 (SOS2)
   05226 Gastric cancer
    102477222 (SOS2)
   05214 Glioma
    102477222 (SOS2)
   05221 Acute myeloid leukemia
    102477222 (SOS2)
   05220 Chronic myeloid leukemia
    102477222 (SOS2)
   05211 Renal cell carcinoma
    102477222 (SOS2)
   05215 Prostate cancer
    102477222 (SOS2)
   05213 Endometrial cancer
    102477222 (SOS2)
   05224 Breast cancer
    102477222 (SOS2)
   05223 Non-small cell lung cancer
    102477222 (SOS2)
  09165 Substance dependence
   05034 Alcoholism
    102477222 (SOS2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102477222 (SOS2)
   05160 Hepatitis C
    102477222 (SOS2)
   05163 Human cytomegalovirus infection
    102477222 (SOS2)
   05165 Human papillomavirus infection
    102477222 (SOS2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102477222 (SOS2)
   01522 Endocrine resistance
    102477222 (SOS2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:tup04990]
    102477222 (SOS2)
Domain-containing proteins not elsewhere classified [BR:tup04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   102477222 (SOS2)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH IQ_SEC7_PH PH_13
Other DBs
NCBI-GeneID: 102477222
NCBI-ProteinID: XP_014447895
LinkDB
Position
Un
AA seq 1322 aa
MHKKILDLEKISLTITQVQEQVHPTLSANEESLYYIEELIFQLLNKLCMAQPRTVQDVEE
RVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGYKVDYPVSLYIVA
VLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDDIGLVSLCEEEPS
SSGELNYYDLVRTEIAEERQYLRELNMIIKVFREAFLSDRKLFKPSDIEKIFSNISDIHE
LTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDILSPEFNEHFTKL
MARPAVAVHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLKACSEEQEDRECLN
QAITALMNLQGSMDRIYKQYSPRRRPGDPVCPFYNRQLRSKHLAIKKMNEIQKNIDGWEG
KDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKPNHSQTRLPGYSSAEYRLKEKF
VMRKIQICDKEDTCECKHAFELVSKDENPIIFAAKSAEEKNNWMAALISLHYRSTLDRML
DSVLLKEENEQPLRLPSPEVYRFVVKDSEENIVFEDNLQSRSGIPIIKGGTVVKLIERLT
YHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADKLAIEKGEQPISADL
KRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDSELLERLESFISSVRGKAMKKWVESIA
KIIKRKKQAQANGISHNITFESPPPPIEWHISRPGQFETFDLMTLHPIEIARQLTLLESD
LYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEAENFEERVAVLSR
IIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRRILDEAVELSQDHFKK
YLVKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKKGKDLINFSKRRKVAEITGEIQQY
QNQPYCLRIEPEMRRFFENLNPMGSASEKEFTDYLFNKSLEIEPRNCKQPPRFPRKSTFS
LKSPGIRPNTGRHGSTSGTLRGHPTPLEREPCKISFSRIAETEIESTVSAPTSPNTPSTP
PVSASSDLSVFLDVDLNSSCGSNSIFAPVLLPHSKSFFSSCGSLHKLSEEPLIPPPLPPR
KKFDHDTSNSKGNMKSDDDPPAIPPRQPPPPKVKPRVPVPTGAFDGPLHSPPPPPPPPRD
PLPDTPPPVPLRPPEHFINCPFNLQPPPPGHLHRDPDWYRDVSTCPNSPSTPPSTPSPRV
PRRCYVLSSSHNNLAHPPAPPVPPRQNSSPHLPKLPPKTYKRELSHPPLYRLPLLENAET
PQ
NT seq 3969 nt   +upstreamnt  +downstreamnt
atgcataaaaaaatactcgatttagagaagatctccttaaccatcactcaggttcaggag
caagtacatcccactctctcagccaacgaagagtctctctattacattgaagagctgatt
tttcagctgcttaataaattgtgcatggcccaaccacggactgttcaagatgtggaggaa
cgagttcaaaagacctttcctcatccaattgataagtgggctatcgctgatgcacaatct
gctatagagaaaagaaaacgaagaaatcctcttttattacctgtggacaaaattcatcct
tcactgaaggaagttttagggtacaaagtagactaccctgtgtccttatatattgtggct
gtactagaatatatctcagctgatattttgaaattggctggtaattatgtttttaacatt
cgacattatgaaatatcacagcaggacattaaagtgtcaatgtgtgcagataaggttttg
atggacatgtttgatcaggatgacataggtttggtttctctctgtgaagaagaacctagt
tcttcaggtgaattaaactactatgatcttgtgagaactgaaattgcagaagaaagacag
tatcttcgggaactaaatatgatcataaaagtgtttcgagaagcctttctttcggacaga
aagctgtttaaaccttctgatattgaaaagattttcagtaacatttccgatatacatgaa
ttgactgtgaaacttttaggtttgattgaagatacagttgaaatgactgatgaaagtagt
cctcatcccttagctggcagttgttttgaagatttggcagaagaacaagcatttgatcct
tatgaaacattgtcacaggacattctatcaccagagtttaatgaacatttcactaagttg
atggccagacctgcagttgctgtacactttcagtccattgccgatggttttaaggaggca
gttcgttacgtccttcctcgccttatgctagtgccagtctatcactgttggcactatttt
gaattattaaagcaattgaaagcatgtagtgaagagcaagaagacagagaatgtttgaac
caagctattacagctctcatgaatctccaaggtagtatggaccgaatttacaagcagtat
tcacctagacggcgacctggggatcctgtgtgccctttttataatcggcagttaagaagc
aagcacctggctatcaaaaaaatgaacgaaattcagaaaaacatagatggatgggaaggc
aaagatattggacagtgttgtaatgaattcattatggaaggaccattgactagaatcggt
gctaaacatgaacggcatatttttctctttgatggcttaatgattagttgtaaacctaat
catagccagacccggcttccaggttatagtagtgcagaatacagattaaaagaaaaattt
gtcatgaggaaaatacaaatctgtgataaagaagatacttgtgagtgcaaacatgctttt
gaattagtatctaaagatgaaaaccctataatatttgctgctaagtctgctgaagagaaa
aataattggatggcagcccttatttctcttcattatcgtagtactctagatcgaatgcta
gattcagtattattaaaagaagaaaatgagcaaccactgagattaccaagtccagaagta
tatcgttttgttgtaaaagactctgaggaaaatattgtatttgaagataacttgcaaagt
cgaagtggaatccccattattaagggaggaactgtggtgaaattaattgaaagattaaca
tatcatatgtatgcagatcccaattttgttcgtacttttcttactacatatcgttcattt
tgtaaaccacaggaattgctaagcttactgattgaacgatttgaaattccagagccagaa
cctactgaagcagataaactggcaatagagaaaggggaacagccaatcagtgcagacctt
aaaagatttcgcaaggaatacgttcaaccagtacaactgaggatcttaaatgtgtttcgg
cactgggttgaacaccatttttatgactttgaaagagattcggaattgctcgaaagactg
gaatccttcatttcaagtgtaagagggaaagctatgaagaaatgggtagagtcaattgct
aagatcatcaaaaggaagaagcaagctcaggcaaatggaataagccataatattaccttt
gaaagtccacctccacccattgaatggcatattagcagaccgggacagttcgaaacattt
gatctcatgacacttcatccaatagagattgcacgtcagctcacacttttggaatctgac
ctctacaggaaagtccagccttctgaacttgttgggagtgtatggaccaaagaagataaa
gaaataaattctccaaatttattaaaaatgattcgccatacaacaaatctcaccctctgg
tttgaaaaatgcattgtggaagcagaaaattttgaagaacgggtggcagtactaagtaga
attatagaaattcttcaagtttttcaagatttgaataatttcaatggagtattggagata
gtcagtgcagtaaattcagtgtcagtgtacagactagaccatacttttgaggcattgcag
gaaagaaaacggagaattttggatgaagctgtggaattaagtcaagatcactttaaaaaa
tacctagtgaaacttaagtcaattaatccaccttgtgtgcctttttttggaatatattta
acaaatattctgaagactgaagaagggaataatgattttttgaaaaagaaagggaaagat
ttaatcaatttcagtaagaggaggaaagtagctgaaattactggagaaattcagcagtat
cagaatcagccttattgcctacggatagaaccagaaatgaggaggttctttgaaaacctt
aaccccatgggaagtgcatctgaaaaagagtttacagattatttgttcaataagtcactg
gaaattgaacctcgaaactgcaaacagccacctcgatttccaaggaaatcaactttctcc
ttaaaatctcctggaataagacctaatacaggccgacatggctctacctcaggcacttta
cgaggtcatccaacaccattagaaagagaaccatgtaaaataagctttagtcggattgct
gaaactgagatcgaatcaacagtgtcagcaccaacctctccaaatacaccatctactcca
ccagtatctgcttcttcagaccttagtgtatttttagatgtggatctcaacagttcctgt
ggcagcaacagcatctttgctcctgtgctgttaccacattcaaagtctttcttcagttcg
tgtggtagtttgcataaattaagtgaagaaccactgattcctcctcctctgcctcctcga
aaaaagtttgatcatgatacttcaaattccaagggaaatatgaaatctgatgatgaccct
cctgctattccaccaagacagccccctcctccaaaggtaaaacccagagttcctgttcct
actggtgcatttgatgggcctctgcatagtccacctccaccaccaccaccaccacgagat
cctcttcctgatactcctccaccagttcctcttcgacctccagaacacttcataaactgt
ccatttaatcttcagccacctccaccgggacatcttcacagagatccagactggtacaga
gacgttagcacatgtccaaattcaccaagcactcctcctagtacaccctctccaagggta
ccacgccgatgctatgtgctcagttctagccacaataatcttgctcatcctccagctcct
cctgttccaccaaggcagaattcaagccctcacctaccaaaactgccaccaaagacttac
aaacgggagctttcacatcccccattgtatagactgcctttgttagaaaatgcagaaact
cctcaatga

KEGG   Tupaia chinensis (Chinese tree shrew): 102494629
Entry
102494629         CDS       T02978                                 

Gene name
SOS1
Definition
(RefSeq) SOS Ras/Rac guanine nucleotide exchange factor 1
  KO
K03099  son of sevenless
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup01521  EGFR tyrosine kinase inhibitor resistance
tup01522  Endocrine resistance
tup04010  MAPK signaling pathway
tup04012  ErbB signaling pathway
tup04014  Ras signaling pathway
tup04062  Chemokine signaling pathway
tup04068  FoxO signaling pathway
tup04072  Phospholipase D signaling pathway
tup04150  mTOR signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04510  Focal adhesion
tup04540  Gap junction
tup04630  JAK-STAT signaling pathway
tup04650  Natural killer cell mediated cytotoxicity
tup04660  T cell receptor signaling pathway
tup04662  B cell receptor signaling pathway
tup04664  Fc epsilon RI signaling pathway
tup04714  Thermogenesis
tup04722  Neurotrophin signaling pathway
tup04810  Regulation of actin cytoskeleton
tup04910  Insulin signaling pathway
tup04912  GnRH signaling pathway
tup04915  Estrogen signaling pathway
tup04917  Prolactin signaling pathway
tup04926  Relaxin signaling pathway
tup04935  Growth hormone synthesis, secretion and action
tup05034  Alcoholism
tup05160  Hepatitis C
tup05161  Hepatitis B
tup05163  Human cytomegalovirus infection
tup05165  Human papillomavirus infection
tup05200  Pathways in cancer
tup05205  Proteoglycans in cancer
tup05206  MicroRNAs in cancer
tup05210  Colorectal cancer
tup05211  Renal cell carcinoma
tup05213  Endometrial cancer
tup05214  Glioma
tup05215  Prostate cancer
tup05220  Chronic myeloid leukemia
tup05221  Acute myeloid leukemia
tup05223  Non-small cell lung cancer
tup05224  Breast cancer
tup05225  Hepatocellular carcinoma
tup05226  Gastric cancer
tup05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102494629 (SOS1)
   04012 ErbB signaling pathway
    102494629 (SOS1)
   04014 Ras signaling pathway
    102494629 (SOS1)
   04630 JAK-STAT signaling pathway
    102494629 (SOS1)
   04068 FoxO signaling pathway
    102494629 (SOS1)
   04072 Phospholipase D signaling pathway
    102494629 (SOS1)
   04151 PI3K-Akt signaling pathway
    102494629 (SOS1)
   04150 mTOR signaling pathway
    102494629 (SOS1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102494629 (SOS1)
   04540 Gap junction
    102494629 (SOS1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102494629 (SOS1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102494629 (SOS1)
   04660 T cell receptor signaling pathway
    102494629 (SOS1)
   04662 B cell receptor signaling pathway
    102494629 (SOS1)
   04664 Fc epsilon RI signaling pathway
    102494629 (SOS1)
   04062 Chemokine signaling pathway
    102494629 (SOS1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102494629 (SOS1)
   04912 GnRH signaling pathway
    102494629 (SOS1)
   04915 Estrogen signaling pathway
    102494629 (SOS1)
   04917 Prolactin signaling pathway
    102494629 (SOS1)
   04926 Relaxin signaling pathway
    102494629 (SOS1)
   04935 Growth hormone synthesis, secretion and action
    102494629 (SOS1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102494629 (SOS1)
  09159 Environmental adaptation
   04714 Thermogenesis
    102494629 (SOS1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102494629 (SOS1)
   05206 MicroRNAs in cancer
    102494629 (SOS1)
   05205 Proteoglycans in cancer
    102494629 (SOS1)
   05231 Choline metabolism in cancer
    102494629 (SOS1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102494629 (SOS1)
   05225 Hepatocellular carcinoma
    102494629 (SOS1)
   05226 Gastric cancer
    102494629 (SOS1)
   05214 Glioma
    102494629 (SOS1)
   05221 Acute myeloid leukemia
    102494629 (SOS1)
   05220 Chronic myeloid leukemia
    102494629 (SOS1)
   05211 Renal cell carcinoma
    102494629 (SOS1)
   05215 Prostate cancer
    102494629 (SOS1)
   05213 Endometrial cancer
    102494629 (SOS1)
   05224 Breast cancer
    102494629 (SOS1)
   05223 Non-small cell lung cancer
    102494629 (SOS1)
  09165 Substance dependence
   05034 Alcoholism
    102494629 (SOS1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102494629 (SOS1)
   05160 Hepatitis C
    102494629 (SOS1)
   05163 Human cytomegalovirus infection
    102494629 (SOS1)
   05165 Human papillomavirus infection
    102494629 (SOS1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102494629 (SOS1)
   01522 Endocrine resistance
    102494629 (SOS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:tup04990]
    102494629 (SOS1)
Domain-containing proteins not elsewhere classified [BR:tup04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   102494629 (SOS1)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_19 PH_10 IQ_SEC7_PH PH_13
Other DBs
NCBI-GeneID: 102494629
NCBI-ProteinID: XP_014444412
LinkDB
Position
Un
AA seq 1333 aa
MQAQQLPYEFFSEENAPKWRGLLVPALKKVQGQVHPTLESNDDALQYVEELILQLLNMLC
QAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEVLGY
KIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFHQDV
EDINILSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLFSAN
DVENIFSRIVDIHELSVKLLGHIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYESYAR
DILRPGFHDRFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQL
EEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK
KMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRL
PGASNAEYRLKEKFFMRKVQINDKDDTNEYKHAFEIILKDENSVIFSAKSAEEKNNWMAA
LISLQYRSTLERMLDVTMLQEEKEEQMRLPSADVYRFAEPDSEENILFEENIQPKAGIPI
IKAGTVIKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLIIERFEIPEPEPTEADR
IAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDADLLQRMEEFIGT
VRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPTVEWHISRPGHVETFDLLTLH
PIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIV
ETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQKKI
LEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKELINFSK
RRKVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIEPRN
PKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETESTASAP
NSPRTPLTPPPASGASSTTDVCSVFDSDHSSPFHSSSDTVFIQVTLPHGPRSASVSSISL
TRGTDEVPIPPPVPPRRRPESAPAESSPSKIMSKHLDSPPAIPPRQPTSKAYSPRYSISD
RTSISDPPESPPLLPPREPVRTPDVFSSSPLHLQPPPLGKKSDHGNAFFPNSPSPFTPPP
PQTPSPHGTRRHLPSPPLTQEVDLHPVAGPPVPPRHSTSQHIPKLPPKTYKREHTHPSMH
RDGPPLLENAHSS
NT seq 4002 nt   +upstreamnt  +downstreamnt
atgcaggcgcagcagctgccgtacgagtttttcagcgaggagaacgcgcccaagtggcgg
ggactgctggtgcctgcgctgaaaaaggtccaggggcaagttcatcctactcttgagtct
aatgatgatgctcttcagtatgttgaagaattaattttgcagttattaaatatgctatgc
caagctcagccacgaagtgcttcagatgtagaggaacgtgttcaaaaaagttttcctcat
ccaattgataagtgggcaatagctgatgcccagtcggctattgaaaagaggaagcggaga
aaccctttatctctgccagtagaaaaaatccatcctttgttaaaggaggtcctaggttat
aaaattgaccatcaggtttctgtttacatagtagcagtattagaatacatttctgcagac
attttaaaactggtgggaaattatgtaagaaatatacggcattatgaaattacaaaacaa
gatattaaagtggcaatgtgtgctgataaggtattaatggatatgtttcatcaagatgta
gaagatataaatatattatctttaactgatgaagagccttccacctcaggagaacaaact
tactatgatttggtaaaagcatttatggcagaaattcgacaatatataagggaactaaat
ctaattattaaggtttttagagagccctttgtctccaattcaaaattgttttctgctaat
gatgtagaaaatatatttagtcgtatagtagatatacatgaacttagtgtgaagttactg
ggccatatagaagatactgtagagatgacagatgaaggcagtccccaccctttagtagga
agctgctttgaagacttagcagaggagcttgcatttgatccttacgaatcatatgctcga
gatattttacgacctggttttcatgatcgcttccttagtcagttatcaaagcctggggca
gcactttatttgcagtcaataggcgaaggtttcaaagaagctgttcaatatgttttaccc
aggctacttctagcccctgtttaccactgtctccattattttgaacttttgaagcagtta
gaagaaaagagtgaagatcaagaagacaaggaatgtttaaaacaagcaataacagccttg
cttaatgttcagagtggtatggaaaaaatatgttctaaaagtcttgcaaaacgaagactg
agtgaatctgcttgtcggttttatagtcagcaaatgaaggggaaacaactagcaatcaag
aaaatgaacgagattcagaagaatattgatggttgggagggaaaagatattggacagtgt
tgcaatgagttcataatggaaggaactcttacacgtgtaggagccaaacatgagagacac
atatttctctttgatggcttaatgatttgctgtaaatcaaatcacgggcagccaagactt
cctggtgctagcaatgcagaatatcgtcttaaagaaaagttttttatgcgaaaggtacaa
attaatgataaagatgacaccaatgaatacaagcatgcttttgaaataattttaaaagac
gaaaatagtgttatattttctgccaagtcagcggaagagaaaaacaattggatggcagca
ttgatatctttacagtaccggagtaccctggaaaggatgcttgatgtaacaatgctacag
gaagagaaggaggagcagatgaggctgcctagtgctgatgtttatagatttgcagagcct
gactctgaagagaatattctgtttgaagagaacatacagcccaaggctggaattccaatt
atcaaagcaggaactgttattaaacttatagagaggcttacgtaccatatgtacgcagat
cctaattttgttcggacatttcttacaacatacaggtccttttgcaaacctcaagaacta
ctgagtcttataatagaaaggtttgaaattccagagcctgagccaacagaagctgatcgc
atagctatagaaaatggagatcagcccttgagtgcggaactaaaaaggtttaggaaagaa
tatatacagcctgtacaactgcgggtattaaatgtctgtcggcactgggtagagcaccac
ttctatgattttgaaagagatgcagaccttttgcaacgaatggaggaatttattggaaca
gtaagaggtaaagcaatgaaaaaatgggttgaatccattactaagataatccaaaggaaa
aaaattgcaagagacaatggaccaggacacaatatcacatttcagagctctcctccaaca
gttgaatggcatataagcaggcctggccatgtagagacttttgacctgctcactttacac
ccaatagaaattgctcgacaactcactttacttgaatcagatctataccgagctgtccag
ccatcagaattagttggaagtgtgtggacaaaagaagacaaagaaattaattctcctaat
cttttgaaaatgatccgacacaccactaatctcactctgtggtttgagaaatgtattgta
gaaactgaaaatttagaagaaagagtagctgtggtgagtcgaataattgagattctccaa
gtctttcaggagttgaataacttcaatggtgttcttgaggttgtcagtgctatgaactca
tcacctgtttacagattagaccatacatttgagcaaataccaagtcgccaaaagaaaatt
ttagaagaagctcatgaattgagtgaagatcattataagaaatacttggcaaaactcagg
tctattaatccaccatgtgtgcctttctttggaatttatctcactaatattttgaaaaca
gaagaaggcaaccctgaggtcctaaaaagacatggaaaagagcttataaacttcagcaag
aggaggaaagtggcagaaataactggagagatccagcagtaccaaaaccagccttactgt
ttacgagtagaatcagatatcaaaaggttcttcgaaaacttgaatccaatgggaaatagc
atggaaaaagaatttacagattaccttttcaacaaatccctcgaaatagagccacgaaat
cctaaacctctcccaagatttccaaaaaaatatagttatcccctaaaatctcccggtgtt
cgtccatcaaacccgagacctggtaccatgagacatcccacacctctgcagcaggagcca
agaaaaattagttacagtcggatccctgaaagtgaaacagagagtacagcctctgcaccc
aattctccaagaacaccgttaacacctcctcctgcttctggtgcttccagtaccacagat
gtttgcagcgtgtttgattctgatcattcaagcccttttcactcaagcagcgataccgtc
tttatccaagttacactgccccatggcccaagatctgcttcagtatcatctataagttta
accaggggcactgatgaagtgcccatcccccctcctgttcctccacgaagacggccagaa
tctgccccagcggaatcttcgccatctaagattatgtctaagcatttggacagcccccca
gccattcctcctaggcaacccacatcaaaagcctattcaccacgatactcgatatcagac
cggacctctatctcagaccctcctgagagccctcccttattaccaccacgagaacctgtg
aggacacctgatgttttctccagctcaccactacatctccagcctccccctctgggcaaa
aaaagtgaccatggcaatgccttcttcccaaacagcccttccccctttacaccacctcct
cctcaaacaccttctcctcatggcacgagaaggcacttgccatcaccaccattgacacag
gaagtggaccttcatccagttgctgggccgcctgttcctccacgacatagcacttctcaa
catatccctaaactccctccaaaaacttacaaaagggagcatacacacccatccatgcac
agagatggaccaccactgttggagaatgcccattcctcctga

DBGET integrated database retrieval system