KEGG   Tupaia chinensis (Chinese tree shrew): 102477477
Entry
102477477         CDS       T02978                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04060  Cytokine-cytokine receptor interaction
tup04066  HIF-1 signaling pathway
tup04151  PI3K-Akt signaling pathway
tup04630  JAK-STAT signaling pathway
tup04640  Hematopoietic cell lineage
tup05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102477477 (EPO)
   04066 HIF-1 signaling pathway
    102477477 (EPO)
   04151 PI3K-Akt signaling pathway
    102477477 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102477477 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102477477 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102477477 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:tup04052]
    102477477 (EPO)
Cytokines and growth factors [BR:tup04052]
 Cytokines
  CSF and other factors
   102477477 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 102477477
NCBI-ProteinID: XP_014446059
LinkDB
Position
Un
AA seq 218 aa
MGVRACPSTPAVLLLCLPHTAPDSLLGCPALPLLLLLLLSLVLLPPGLPVLGAPARLICD
SRVLERYILEAKEAENVTMGCAEDGSLSENITVPDTKVNFYVWKRMEVSQQAVEVWQGLA
LLSEAIQRGQALLANSSQPSETLQLHVDKAVSGLRSLTSLLRALGAQKEAMSPPDAASAA
PLRTFTVDTLCKLFRIYSNFLRGKLKLYTGEACRRGDR
NT seq 657 nt   +upstreamnt  +downstreamnt
atgggggtgcgcgcctgcccctccacaccagcagttctgctcctctgcctgcctcacact
gcacctgactctcttctaggatgtcctgccctgccgcttctgcttctgcttctgctgagc
ttggtgctgcttcctccgggtctcccagtcctgggcgcccccgctcgcctcatctgtgat
agccgagtcctggagaggtacattctggaggccaaggaggctgagaatgtgacgatgggc
tgtgctgaagacggcagcttgagcgagaatatcaccgtcccagacaccaaagttaacttc
tacgtctggaaaaggatggaggtcagtcagcaggctgtggaagtctggcagggcctggcc
ctgctctcagaagccatccaacggggccaggccctgttggccaactcctcccagccatca
gaaaccctgcagctgcatgtagacaaagctgtcagtggcctccggagcctcacctccttg
cttcgggcactgggagcccagaaggaagccatgtctcctccagatgcagcctcagctgcc
ccactccgtacatttactgtcgatacgctgtgtaaacttttccgaatctactccaatttc
ctccggggaaagctgaagctgtacacgggggaggcctgcaggagaggggacaggtga

DBGET integrated database retrieval system