KEGG   Tupaia chinensis (Chinese tree shrew): 102478604
Entry
102478604         CDS       T02978                                 

Gene name
ATP2A3
Definition
(RefSeq) ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 3
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04020  Calcium signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04024  cAMP signaling pathway
tup04260  Cardiac muscle contraction
tup04261  Adrenergic signaling in cardiomyocytes
tup04919  Thyroid hormone signaling pathway
tup04972  Pancreatic secretion
tup05010  Alzheimer disease
tup05017  Spinocerebellar ataxia
tup05022  Pathways of neurodegeneration - multiple diseases
tup05410  Hypertrophic cardiomyopathy
tup05412  Arrhythmogenic right ventricular cardiomyopathy
tup05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    102478604 (ATP2A3)
   04024 cAMP signaling pathway
    102478604 (ATP2A3)
   04022 cGMP-PKG signaling pathway
    102478604 (ATP2A3)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102478604 (ATP2A3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102478604 (ATP2A3)
   04261 Adrenergic signaling in cardiomyocytes
    102478604 (ATP2A3)
  09154 Digestive system
   04972 Pancreatic secretion
    102478604 (ATP2A3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102478604 (ATP2A3)
   05017 Spinocerebellar ataxia
    102478604 (ATP2A3)
   05022 Pathways of neurodegeneration - multiple diseases
    102478604 (ATP2A3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102478604 (ATP2A3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102478604 (ATP2A3)
   05414 Dilated cardiomyopathy
    102478604 (ATP2A3)
Enzymes [BR:tup01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     102478604 (ATP2A3)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Hydrolase Cation_ATPase Cation_ATPase_N Hydrolase_3 HAD DUF3106
Other DBs
NCBI-GeneID: 102478604
NCBI-ProteinID: XP_006167661
LinkDB
Position
Un
AA seq 999 aa
MEAAHLLPAADVLCGFSVTAESGLSPEQVTGARERFGPNELPSEEGKSLWELVLEQFDDL
LVRILLLAALVSFVLAWFEEGEETTTAFVEPLVIMLILVANAVVGVWQERNAESAIEALK
EYEPEMGKVIRSDRKGVQRIRARDIVPGDIVEVAVGDKVPADLRLVEIKSTTLRVDQSIL
TGESVSVTKHTDPIPDPRAVNQDKKNMLFSGTNIASGKAVGVAVATGLHTELGKIRSQMA
AVEPERTPLQRKLDEFSRQLSHAISVICVAVWIINIGHFADPAHGGSWLRGAVYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMARKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVCRMFVVAEADAGSCRLHEFTISGTTYTPEGEVRQGERLVRCGQFDGLVELATICAMC
NDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTDLQALSRVERAGACNAVIKQLMR
KEFTLEFSRDRKSMSVYCTPTRSNPATQGSKMFVKGAPESVIERCSSVRVGSRTAPLNST
CREQILAKIRDWGSGSDTLRCLALATRDAPPRKEDMQLDDCSKFAQYETDLTFVGCVGML
DPPRPEVAACITRCRQAGIRVVMITGDNKGTAVAICRRLGIFGDTEDVAGKAYTGREFDD
LSPEQQRHACRTACCFARVEPTHKSRIVENLQSFNEITAMTGDGVNDAPALKKAEIGIAM
GSGTAVAKSAAEMVLSDDNFASIVAAVEEGRAIYSNMKQFIRYLISSNVGEVVCIFLTAI
LGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKLPRNPHEALISGWLFFRYLAI
GVYVGLATVAAATWWFLYDAEGPHVTFYQLRNFLKCSEDNPLFAGIDCEVFESRFPTTMA
LSVLVTIEMCNALNSVSENQSLLRMPPWLNPWLLAAVAVSMALHFLILLVPPLPLIFQVT
PLSGRQWVVVLQISLPVILLDEALKYLSRHHVDEGKQQK
NT seq 3000 nt   +upstreamnt  +downstreamnt
atggaggcggcgcacctgctcccggccgccgacgtgctgtgcggcttctcagtgacagcc
gagagcggcctgagcccggagcaggtgactggcgctcgggagcgcttcggccccaacgag
ctcccgtccgaggaagggaagtccctgtgggagctggtgctggagcagtttgacgacctc
ctggtgcgcatcctgctgctggccgccctggtctccttcgtcctggcctggttcgaggag
ggcgaggagaccacgaccgccttcgtggagccgctggtcatcatgctgatcctcgtggcc
aatgcagtcgtgggtgtgtggcaggaacgcaatgccgagagcgccatcgaggccttgaag
gagtatgagcctgagatgggcaaggtgatccgctcggaccgcaagggtgtgcagaggatc
cgggcccgggacatcgtccctggagacattgtggaagtggcagtgggagacaaagtgccc
gccgacctccgtctcgtggagatcaagtccaccacgctgagagtggaccagtccatcctg
acaggtgaatctgtgtctgtgaccaagcatacagaccccatcccagaccccagagctgtg
aaccaggacaagaagaacatgctgttttctggcacgaatattgcatcaggcaaggcagtg
ggtgtggcagtggccacgggcctgcacacggaactgggcaagatccggagccagatggcg
gcggtggagcccgagcgcacgccgctgcagcgcaagctggacgagtttagccggcagctg
tcccacgccatctccgtgatctgcgtggccgtgtggatcatcaacatcggccactttgcc
gacccggcccatggcggctcctggctccgcggagctgtctactacttcaagatcgccgtg
gccctggctgtggctgccatccccgaaggccttccggctgtcatcactacatgcctggcg
ctgggcacgcggcgcatggcacgcaagaatgccatcgtgcggagcctgccctctgtggag
accctgggctgcacctcggtcatctgctctgacaagacaggcacgctcaccaccaaccag
atgtctgtctgccggatgttcgtggtagccgaggccgatgcaggctcctgccgtttacac
gagttcaccatctcgggaaccacatatactccagagggcgaagtgcggcagggggagcgg
cttgtgcgctgcgggcagttcgatgggctggtggagctggccaccatctgtgccatgtgc
aacgactcagcgctggactacaacgaggccaagggcgtgtatgagaaggtgggagaggcc
acagagacggctctgacctgcctggtggagaagatgaacgtgttcgacactgacctgcag
gctctgtcccgagtggagcgagctggtgcctgcaatgccgtcatcaagcagctgatgcgg
aaggagttcaccctcgagttctcccgggaccggaagtctatgtcagtgtactgcacgccc
acccgctctaaccctgcaacccagggcagcaagatgtttgtgaagggggctcctgagagt
gtaatcgagcgctgcagctccgtccgagtggggagccgcacagcacccctgaactccacc
tgcagggagcaaatcctggcaaagatccgggactggggctcaggctcagacacactgcgc
tgcctggcgctggccaccagggatgccccgccgaggaaggaggacatgcagctggacgac
tgcagcaaatttgcacagtacgagacggacctgaccttcgtgggctgtgtgggcatgctg
gacccgccgcggcccgaggtggctgcctgtattactcgctgccgccaggcaggcatccgg
gtggttatgatcacaggggacaacaaaggcacggctgtcgccatctgtcgccggcttggc
atctttggagacacggaggacgtggcgggcaaggcctacacaggccgcgaattcgacgac
ctcagtcctgagcagcagcgccatgcctgccgcaccgcctgctgtttcgcccgggtggag
cccacacacaagtcccgcatcgtggagaacctacagtcatttaacgagataactgccatg
actggtgatggggtgaacgatgcaccagccctgaagaaagcggagatcggcattgccatg
ggctcaggcacagccgtggccaagtcggcggcagagatggtgctgtcagatgacaacttt
gcctccatcgtggctgcggtggaagagggccgggccatctacagcaacatgaagcagttc
atccgctacctcatctcctccaacgtcggcgaggtcgtctgcatcttcctcacggcaatt
ctgggcctgcccgaagccctgatccccgtgcagctgctctgggtgaacctggtgacagat
ggcctcccggccacggccctaggcttcaacccaccagatctggacatcatggagaagctg
ccccggaaccctcacgaagccctcatcagtggctggctcttcttccgatatctggctatt
ggagtgtatgtaggcctggccacagtagctgctgccacctggtggttcctgtatgacgcc
gagggacctcatgtgaccttctaccagctgaggaacttcctgaaatgctccgaagacaac
ccgctcttcgccggcattgactgcgaggtcttcgagtcacgcttccccacgaccatggcc
ttgtctgtgctcgtgaccatcgaaatgtgcaatgccctcaacagcgtctccgagaaccag
tcgctgctgcggatgccgccctggctgaacccctggctgctggcggctgtggccgtgtcc
atggccctgcacttcctcatcctgctcgtgccacccctgcccctcattttccaggtgacc
cctctaagtgggcgccagtgggtggtggtgctccagatatctctgcctgtcatcctgctt
gacgaggccctcaagtacctgtcccgacatcatgtggatgaaggaaagcagcagaagtga

KEGG   Tupaia chinensis (Chinese tree shrew): 102497660
Entry
102497660         CDS       T02978                                 

Definition
(RefSeq) sarcoplasmic/endoplasmic reticulum calcium ATPase 2
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04020  Calcium signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04024  cAMP signaling pathway
tup04260  Cardiac muscle contraction
tup04261  Adrenergic signaling in cardiomyocytes
tup04919  Thyroid hormone signaling pathway
tup04972  Pancreatic secretion
tup05010  Alzheimer disease
tup05017  Spinocerebellar ataxia
tup05022  Pathways of neurodegeneration - multiple diseases
tup05410  Hypertrophic cardiomyopathy
tup05412  Arrhythmogenic right ventricular cardiomyopathy
tup05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    102497660
   04024 cAMP signaling pathway
    102497660
   04022 cGMP-PKG signaling pathway
    102497660
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102497660
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102497660
   04261 Adrenergic signaling in cardiomyocytes
    102497660
  09154 Digestive system
   04972 Pancreatic secretion
    102497660
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102497660
   05017 Spinocerebellar ataxia
    102497660
   05022 Pathways of neurodegeneration - multiple diseases
    102497660
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102497660
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102497660
   05414 Dilated cardiomyopathy
    102497660
Enzymes [BR:tup01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     102497660
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase Cation_ATPase Hydrolase Hydrolase_3 HAD
Other DBs
NCBI-GeneID: 102497660
NCBI-ProteinID: XP_014443554
LinkDB
Position
Un
AA seq 886 aa
DKLRADIKLTSIKSTTLRVDQSILTGESVSVIKHTDPVPDPRAVNQDKKNMLFSGTNIAA
GKAMGVVVATGVNTEIGKIRDEMVATEQERTPLQQKLDEFGEQLSKVISLICIAVWIINI
GHFNDPVHGGSWIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSL
PSVETLGCTSVICSDKTGTLTTNQMSVCRMFILDKVEGDTCSLNEFTITGSTYAPIGEVH
KDDKLVKCHQYDGLVELATICALCNDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFD
TELKGLSKIERANACNSVIKQLMKKEFTLEFSRDRKSMSVYCTPNKPSRTSMSKMFVKGA
PEGVIDRCTHVRVGSTKVPMTPGVKQKIMSVIREWGSGSDTLRCLALATHDNPLRREEMH
LEDSANFIKYETNLTFVGCVGMLDPPRIEVASSVKLCRQAGIRVIMITGDNKGTAVAICR
RIGIFGQDEDVTAKAFTGREFDELNPSAQRDACLNARCFARVEPSHKSKIVEFLQSFDEI
TAMTGDGVNDAPALKKAEIGIAMGSGTAVAKTASEMVLANDNFSTIVAAVEDGRAIYNNM
KQFIRYLISSNVGEVVCIFLTAALGFPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIM
NKPPRNPKEPLISGWLFFRYLAIGCYVGAATVGAAAWWFIAADGGPRVSFYQLSHFLQCK
EDNPDFEGVDCAIFESPYPMTMALSVLVTIEMCNALNSLSENQSLLRMPPWENIWLVGSI
CLSMSLHFLILYVEPLPLIFQITPLNLTQWLMVLKISLPVILMDETLKFVARNYLEPGKE
CVQPATKPCSFSACTDGISWPFVLLIMPLVIWVYSTDTNFSDMFWS
NT seq 2661 nt   +upstreamnt  +downstreamnt
gacaagttgcgtgctgatataaaattaacttccatcaaatctaccacactaagagtggac
cagtcgattctcacaggtgaatctgtttctgtaatcaagcacactgaccctgtcccagac
ccacgggctgtcaaccaagataagaaaaacatgctcttttctggtacaaacattgctgct
ggaaaagccatgggagtggtggtggcaactggagttaacacagaaatcggcaagatccgg
gatgaaatggtcgcaacggaacaagagagaacaccccttcagcagaagctagatgagttc
ggggaacagctctccaaagtcatctccctgatttgtatcgcagtctggatcataaacatt
gggcacttcaatgacccagtccatgggggctcctggatcagaggtgctatttactacttc
aaaatcgcagtggccctggctgtcgcagccattcctgaaggtctgcccgctgtcatcact
acctgcctagctctcggaactcgtaggatggcaaagaaaaatgccattgttcgaagcctc
ccttctgtggaaaccctcggttgtacttctgttatctgctctgacaagaccggtacactt
acgacaaaccagatgtcagtctgcaggatgttcattctggacaaagttgaaggtgatact
tgttcccttaatgagtttaccataactgggtcaacatatgcacctattggagaagtgcat
aaagatgataagctagtgaaatgccaccagtacgacgggcttgtggaattagcaacaatc
tgtgccctttgtaatgactctgctttggattacaatgaggcgaagggtgtgtatgaaaaa
gttggagaagctacagagactgctctgacctgcctggtagagaagatgaacgtgtttgat
actgagttgaagggtctttctaaaatagaacgtgccaatgcctgcaactcggtcattaaa
cagctgatgaaaaaggagtttactctggagttttctcgtgacaggaaatctatgtcggtt
tactgtacaccaaacaaaccaagccggacatcaatgagcaagatgtttgtgaagggagca
cccgaaggtgtcattgacaggtgcactcacgttcgagttggaagtacaaaggtccctatg
acccctggagtcaaacagaagatcatgtctgtcattcgggaatggggcagtggcagtgac
acattgcgatgcctggccctggccactcatgacaacccactgaggagggaagaaatgcac
ctcgaagactcggccaacttcattaaatacgagaccaatctgactttcgtcggctgtgtg
ggcatgctggatcctccgagaattgaggtggcctcctctgtgaagctgtgtcggcaagca
ggcatccgggtcatcatgatcacaggggacaataagggcactgctgtggccatctgtcgc
cgcattggcatcttcgggcaggacgaggatgtgacagccaaggctttcacgggtcgggag
tttgacgaactcaatccctcagcccagagggatgcctgcttgaatgcccgctgtttcgct
cgggttgagccctctcacaagtccaagatcgtagagtttcttcagtcttttgatgagatt
acagctatgactggcgatggggtgaatgatgctcctgctctgaagaaagccgagattggt
attgccatgggttctggcaccgcagtggctaaaactgcctctgaaatggtcctggccaat
gacaacttctcgaccatcgtagctgctgtggaggatgggcgggccatatacaacaacatg
aagcagttcatccgctacctcatctcgtccaacgtgggggaagtcgtctgtattttcctg
acagcggcgcttggctttcctgaggctttgattcctgtccagctgctctgggtcaatctg
gtgacagacggcctgcctgctactgcgctgggcttcaatccccctgatctggacatcatg
aataaacctccacggaaccccaaggagccactcatcagtggctggctcttcttccgttac
ctggctattggctgttacgtcggcgctgctaccgtgggtgctgctgcgtggtggttcatc
gctgccgacggcggtcccagagtgtccttctaccagctgagtcatttcctccagtgtaaa
gaggacaacccggactttgaaggagtggattgtgcaatctttgaatctccctacccaatg
acaatggcactgtctgtcctagtaaccatcgagatgtgtaacgcgctcaacagcttgtct
gagaaccagtccttgctgaggatgcccccatgggagaacatctggctcgtgggctctatc
tgcctgtccatgtcgctccacttcctgattctctatgtagagcctttgccacttatcttc
cagatcacaccgctgaatttgacccagtggctgatggtgctgaaaatctccttgcctgtg
attctcatggacgagaccctcaagttcgtggcccgcaactacctggagcctggtaaagag
tgtgtgcagcctgccaccaaaccctgctccttctcggcatgcaccgacgggatttcctgg
ccattcgtgctgctcataatgcccctggtgatctgggtctatagcacagacactaacttt
agtgacatgttctggtcctga

KEGG   Tupaia chinensis (Chinese tree shrew): 102499870
Entry
102499870         CDS       T02978                                 

Gene name
ATP2A1
Definition
(RefSeq) ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04020  Calcium signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04024  cAMP signaling pathway
tup04260  Cardiac muscle contraction
tup04261  Adrenergic signaling in cardiomyocytes
tup04919  Thyroid hormone signaling pathway
tup04972  Pancreatic secretion
tup05010  Alzheimer disease
tup05017  Spinocerebellar ataxia
tup05022  Pathways of neurodegeneration - multiple diseases
tup05410  Hypertrophic cardiomyopathy
tup05412  Arrhythmogenic right ventricular cardiomyopathy
tup05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    102499870 (ATP2A1)
   04024 cAMP signaling pathway
    102499870 (ATP2A1)
   04022 cGMP-PKG signaling pathway
    102499870 (ATP2A1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102499870 (ATP2A1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102499870 (ATP2A1)
   04261 Adrenergic signaling in cardiomyocytes
    102499870 (ATP2A1)
  09154 Digestive system
   04972 Pancreatic secretion
    102499870 (ATP2A1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102499870 (ATP2A1)
   05017 Spinocerebellar ataxia
    102499870 (ATP2A1)
   05022 Pathways of neurodegeneration - multiple diseases
    102499870 (ATP2A1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102499870 (ATP2A1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102499870 (ATP2A1)
   05414 Dilated cardiomyopathy
    102499870 (ATP2A1)
Enzymes [BR:tup01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     102499870 (ATP2A1)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase_N Cation_ATPase Hydrolase Hydrolase_3 HAD
Other DBs
NCBI-GeneID: 102499870
NCBI-ProteinID: XP_014443214
UniProt: L9KV97
LinkDB
Position
Un
AA seq 1001 aa
MEAAHSKSTEECLAYFGVSETTGLTPDQVKRHLEKYGPNELPAEEGKSLWELVVEQFEDL
LVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILIANAIVGVWQERNAENAIEALK
EYEPEMGKVYRADRKSVQRIKARDIVPGDIVEVAVGDKVPADIRILSIKSTTLRVDQSIL
TGESVSVIKHTEPVPDPRAVNQDKKNMLFSGTNIAAGKAVGVVATTGVNTEIGKIRDQMA
ATEQDKTPLQQKLDEFGEQLSKVISLICVAVWLINIGHFNDPVHGGSWFRGAIYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVCKMFIIDKVEGDICVLNEFSITGSTYAPEGEVLKNDKPIRAGQFDGLVELATICALC
NDSSLDFNETKGVYEKVGEATETALTTLVEKMNVFNTDVRSLSKVERANACNSVIRQLMK
KEFTLEFSRDRKSMSVYCSPAKSSRAAVGNKMFVKGAPEGVIDRCNYVRVGTTRVPLTGP
VKEKIMTVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFMEYETDLTFVGVVGML
DPPRKEVTGSIQLCRDAGIRVIMITGDNKGTAIAICRRIGIFGENEEVADRAYTGREFDD
LPLGEQREACRRACCFARVEPSHKSKIVEYLQSYDEITAMTGDGVNDAPALKKAEIGIAM
GSGTAVAKTASEMVLADDNFSTSVAAVEEGRAIYNNMKQFIRYLISSNVGEVVCIFLTAA
LGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMDRPPRSPKEPLISGWLFFRYMAI
GGYVGAATVGAAAWWFLYAEDGPRVTYNQLTHFMQCTEHNPDFDGLDCEIFEAPEPMTMA
LSVLVTIEMCNALNSLSENQSLLRMPPWVNIWLLGSICLSMSLHFLILYVDPLPMIFKLR
ALDLTQWLMVLKISLPVIGLDELLKFIARNYLEDPEDERRK
NT seq 3006 nt   +upstreamnt  +downstreamnt
atggaggccgcacactccaagtccacagaggaatgtctagcctattttggggtgagtgag
accaccggcctcaccccggaccaagttaagcggcatctggagaaatacggccccaatgaa
ctccctgctgaggaagggaagtccctgtgggagttggtggtggagcagtttgaagacctc
ctggtgcggatccttctcctggccgcctgcatttcctttgtgctggcctggtttgaggaa
ggcgaggagaccatcactgcctttgtcgagccctttgtcatcctcttgatcctcatcgcc
aacgccatcgtgggggtttggcaggagcgtaatgcagagaacgccatcgaggctctgaag
gagtatgaacccgagatggggaaggtctacagggctgaccgcaagtcagtgcaaaggatc
aaggctcgggacattgtccctggagacattgtggaggtggctgtgggggacaaagtccct
gcagatatccgcatcctctccatcaagtccaccaccctccgggtcgaccagtccattctg
acaggcgagtctgtatctgtcatcaagcacacagagcctgttcctgacccccgagctgtc
aaccaggacaagaagaacatgcttttctcgggtaccaacattgcagccggcaaggccgtg
ggtgtcgtggccaccaccggtgtgaacaccgagatcgggaagatccgtgaccaaatggcc
gccacggagcaggacaagacccctctgcagcagaagctggatgagtttggggagcagctc
tccaaggtcatctccctcatctgtgtggctgtgtggctcatcaacatcggccacttcaac
gatcccgtgcacgggggctcctggttccgcggtgccatctactactttaagattgccgtg
gccctggctgtggctgccatcccagaaggtctccctgcagtcatcaccacatgcctggca
ctgggcacccggcggatggcaaagaagaacgccatcgtcaggagcttgccctccgtagag
accctgggctgcacctctgtcatctgttccgacaagacgggcaccctgaccaccaaccag
atgtccgtctgcaagatgtttatcatcgacaaggtggaaggcgacatctgcgtgctgaat
gagttttccatcactggttccacttacgcgccagagggagaggtcctgaagaatgataaa
cccatccgggcagggcagtttgatgggctggttgaactggccaccatttgtgccctctgc
aatgactcctccttggacttcaacgagaccaaaggtgtctatgagaaggtcggtgaggcc
accgagacggcgctgaccaccttggtggagaagatgaatgtgttcaacacagacgtgagg
agcctctcgaaggtggagagggccaacgcctgcaactctgtgattcgccagctaatgaag
aaggaattcaccctggagttctcccgagacaggaaatccatgtctgtctattgctcccca
gccaagtcttcccgggctgctgtgggcaacaagatgtttgtcaagggtgcccctgagggg
gtcatcgaccgctgtaactatgtgcgagttggcaccacccgggtgccactgacagggccg
gtgaaggagaagatcatgacagtgatcaaggaatggggcactggccgggacaccctgcgc
tgcctggccctggccacccgcgacaccccccctaagcgagaggagatggtcctggatgat
tctgccaggttcatggagtatgagacggacctgacattcgtgggtgtggtgggcatgttg
gacccaccccgcaaggaggtcacaggctccatccagctgtgccgtgacgccgggatccgt
gtcattatgatcactggggacaacaagggcacagccattgccatctgccgacgaatcggc
atctttggggaaaacgaggaggtggcggaccgtgcctacactggccgtgagttcgacgac
ctgcccctgggtgagcagcgggaagcctgccgccgcgcctgctgcttcgcccgcgtggag
ccctcccacaagtcgaagatcgtggagtatctgcagtcctacgatgagatcacagcgatg
acaggtgatggtgtcaacgatgccccagccctgaagaaggccgagatcggcattgccatg
ggctctggcacagccgtggccaagactgcctctgagatggtgctggccgacgacaacttc
tccaccagtgtggcagccgtggaggagggccgggccatctacaacaacatgaagcagttc
atccgctacctcatctcctccaacgtgggtgaggtggtctgcatcttcctgacagccgcc
ctggggctgcctgaggcgctgatccctgtgcagctgctgtgggtgaacctggtgactgac
gggctcccagccacagccctgggcttcaaccccccagacctggacatcatggaccggccc
ccacggagccctaaggagcccctcatcagtggctggctcttcttccgctatatggcaatt
gggggctacgtgggtgcagccaccgtgggagcagctgcctggtggttcctgtacgccgag
gacgggcctcgtgtcacctacaaccagctgacccacttcatgcagtgcactgagcacaac
ccggactttgacggcctagactgtgagatcttcgaggccccggagcccatgaccatggcc
ttgtctgtgctggtcaccatcgagatgtgcaacgctctcaacagcctgtctgagaaccag
tccctgctgcggatgccgccctgggtgaacatctggctgctgggctccatctgcctctcc
atgtccctgcacttcctcatcctctacgtcgaccccctgccgatgatcttcaagctccga
gccctggacctcacccagtggctcatggtcctcaagatctcacttccagtcatcgggctc
gacgaactcctcaagttcattgctcggaactacctggaggatccagaagatgaaagaagg
aagtga

KEGG   Tupaia chinensis (Chinese tree shrew): 106734944
Entry
106734944         CDS       T02978                                 

Definition
(RefSeq) sarcoplasmic/endoplasmic reticulum calcium ATPase 2-like
  KO
K05853  P-type Ca2+ transporter type 2A [EC:7.2.2.10]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
tup04020  Calcium signaling pathway
tup04022  cGMP-PKG signaling pathway
tup04024  cAMP signaling pathway
tup04260  Cardiac muscle contraction
tup04261  Adrenergic signaling in cardiomyocytes
tup04919  Thyroid hormone signaling pathway
tup04972  Pancreatic secretion
tup05010  Alzheimer disease
tup05017  Spinocerebellar ataxia
tup05022  Pathways of neurodegeneration - multiple diseases
tup05410  Hypertrophic cardiomyopathy
tup05412  Arrhythmogenic right ventricular cardiomyopathy
tup05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:tup00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    106734944
   04024 cAMP signaling pathway
    106734944
   04022 cGMP-PKG signaling pathway
    106734944
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    106734944
  09153 Circulatory system
   04260 Cardiac muscle contraction
    106734944
   04261 Adrenergic signaling in cardiomyocytes
    106734944
  09154 Digestive system
   04972 Pancreatic secretion
    106734944
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106734944
   05017 Spinocerebellar ataxia
    106734944
   05022 Pathways of neurodegeneration - multiple diseases
    106734944
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    106734944
   05412 Arrhythmogenic right ventricular cardiomyopathy
    106734944
   05414 Dilated cardiomyopathy
    106734944
Enzymes [BR:tup01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     106734944
SSDB
Motif
Pfam: Cation_ATPase_N E1-E2_ATPase RuvB_C
Other DBs
NCBI-GeneID: 106734944
NCBI-ProteinID: XP_014443612
LinkDB
Position
Un
AA seq 168 aa
MENAHTKTVEEVLGHFGVNESTGLSLEQVKKLKERWGSNELPAEEGKTLLELVIEQFEDL
LVRILLLAACISFVLAWFEEGEETITAFVEPFVILLILVANAIVGVWQERNAENAIEALK
EYEPEMGKVYRQDRKSVQRIKAKDIVPGDIVEIAGELSLPLFLYRLYF
NT seq 507 nt   +upstreamnt  +downstreamnt
atggagaacgcgcacacaaagacggtggaagaggtgctgggccacttcggcgtcaacgag
agcacggggctgagcctggagcaggtcaagaagctcaaggagagatggggctccaacgag
ctgccggctgaagaaggaaaaaccttgctggaacttgtgattgagcagtttgaagactta
ttagttagaattttactgctggcagcgtgtatatctttcgttttggcttggtttgaagaa
ggtgaagaaacaattacagcctttgtagaaccttttgtaattttacttatattagtagcc
aatgcaattgtgggtgtatggcaggaaagaaatgctgaaaatgcgattgaagccctgaag
gagtacgagcctgaaatgggcaaagtgtatcgccaggacaggaaaagcgtacagcggatt
aaagctaaagacatagttcctggggatattgtagaaattgctggtgagttaagtttgcca
cttttcctttatagattgtatttctga

DBGET integrated database retrieval system